KEGG   Citrobacter rodentium: ROD_43631Help
Entry
ROD_43631         CDS       T01145                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cro  Citrobacter rodentium
Pathway
cro00250  Alanine, aspartate and glutamate metabolism
cro00410  beta-Alanine metabolism
cro00640  Propanoate metabolism
cro00650  Butanoate metabolism
cro01100  Metabolic pathways
cro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ROD_43631 (puuE)
   00650 Butanoate metabolism
    ROD_43631 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ROD_43631 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ROD_43631 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cro01007]
    ROD_43631 (puuE)
Enzymes [BR:cro01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ROD_43631 (puuE)
Amino acid related enzymes [BR:cro01007]
 Aminotransferase (transaminase)
  Class III
   ROD_43631 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBG91059
UniProt: D2TKU5
LinkDB All DBs
Position
4609654..4610919
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCDYFVEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVSLAERINAIAPIDGPAKTAFFTTGAEAVENAVKI
ARASTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVTVE
EALNSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPAAFMQALRKICDTHGILLIADEV
QTGFARTGKVFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDIIEEEQLCQRANQLGEHLKEVLNQAREHCPAIADVRGLGSMVAVEFND
PQTGKPSADFTRQIQRKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILTRVLR
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcagcgtcgtcagcaggcgactccccgtggtgtaggtgtg
atgtgcgactactttgtggagaaagccgagaacgccacgctgtgggatgtggaaggtaat
gaagtgatcgattttgccgccgggatcgcggtgctgaataccggccatcgccatccgaag
attgtggccgcggtagaacaacagctgcaggcgtttacccacactgcgtaccagattgtt
ccatacgagagctacgtttcgctggcggagcgcatcaacgccatcgcgccgattgacggt
ccggcaaaaaccgccttcttcaccaccggtgcggaagcggtagaaaacgcggtgaagatc
gcccgcgccagcaccggccgtcccggtttaatcaccttcggcggcggctttcatggccgt
acctttatgacgatggcgctgaccggcaaagtggcgccttacaaaataggctttggcccg
ttccctggttcggtttaccacgccgtatacccgaacgcggcccacggcgtgaccgttgag
gaggcgctcaacagcctggaacgcatcttcaaagccgatatcgccgccgatcaggtagca
gcgattgtgctggagccgattcagggcgagggcggttttaacgtcgcacctgccgccttt
atgcaggcgctgcgcaagatttgcgatacccacggcattctgctgatcgccgatgaagta
cagaccggcttcgcccgcaccgggaaagtcttcgcaatgcagcattacgacgtgaagcct
gacctgatgacgatggcgaaaagcctggcgggcggcttcccgctctccggcgtggtcggg
cgggcggaggtcatggatgcccctgcgccgggtggtctgggcggcacctacgccggtaat
ccgctggcggttgccgccgcgcatgcggtgctggatatcatcgaagaagaacagctgtgc
cagcgggcgaaccagctgggcgaacacctgaaagaagtgctgaatcaggcgcgcgaacac
tgcccggcgattgctgacgtccgcgggctgggatcgatggtggcggtggaatttaacgat
ccgcaaaccgggaaaccgtccgctgactttacccgccagatccagcgtaaagcgcaggaa
aacggtctgctgctgttgagctgcggcgtgtatggcaacgttattcgtttcctctacccg
ttaacgatcccggatgcgcagttcagcaaagcgctggatattctgacccgcgtgctgcgg
ggctga

DBGET integrated database retrieval system