KEGG   Citrobacter rodentium: ROD_43981Help
Entry
ROD_43981         CDS       T01145                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cro  Citrobacter rodentium
Pathway
cro00564  Glycerophospholipid metabolism
cro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ROD_43981 (glpD)
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ROD_43981 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: CBG91093
UniProt: D2TLL3
LinkDB All DBs
Position
complement(4647295..4648803)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGSESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVQKGGEVLTRTRATAARRENG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKEFFDEGMHLPSPYGIRLIKGSHIVVPRVH
SQKQAYILQNEDKRIVFVIPWMEEFSIIGTTDVEYHGDPKAVKIDESEINYLLKVYNAHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSGYYQGIGPAWTKECVLPGGDIGGDREDYAAKLRRRYPFLSESLARHYART
YGSNSGLILGEATSLADLGENFGHEFYEAELKYLVDHEWVRRADDALWRRTKEGMWLNAE
QQSRVTQWLTAYMEKHPLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgatagggggaggcatcaacggtgccggtatcgcggca
gatgccgccggacgcggtttatccgtgctgatgctggaagcgcaggatcttgcgtgcgcc
acctcttccgccagctcgaaacttattcacggcggcctgcgctacctggagcactatgaa
ttccgtctggtcagcgaagcgctggccgaacgtgaagtattgctgaaaatggcgccgcat
atcgccttcccgatgcgattccgcctgccgcaccgcccacatttgcgtccggcatggatg
atccgcattggtctgtttatgtacgatcacctgggtaaacgtaccagcctgccgggctcg
accggtttgcgttttggctcagagtccgtcctgaagcccgaaatcgtgcgcggtttcgaa
tactctgactgctgggtggacgatgcccgcctggtgctggcgaacgcgcagatggtggtg
caaaaaggcggcgaggtgttaacccgcacccgggcgaccgccgcacgccgcgaaaacggc
ctgtggattgtcgaagcggaagatatcgataccggcaagaaatacacctggcaggcgcgc
ggtctggttaacgctaccggtccatgggtaaaagaatttttcgacgaggggatgcacctg
ccgtcgccgtacggcattcgtctgatcaaaggcagccatatcgtggtgccgcgcgttcac
agccagaaacaggcctacatcctgcaaaacgaagacaagcgtattgtgtttgtgattccg
tggatggaggagttctcgatcatcggcaccaccgacgtcgagtaccacggcgacccgaaa
gcggtgaaaatcgacgaaagcgaaattaactatctgctgaaggtgtataacgctcacttt
aagaaacagctgggtcgcgacgatatcgtctggacctactccggggtgcgcccgctgtgc
gatgacgaatccgattcgccgcaggccatcacccgtgactatacgctggatattcatgac
gagaacggcaaagcgccgctgctatcagttttcggcggcaaactgacgacctaccgcaag
ctcgccgaacacgcgatggaaaaactgtcgggttactatcagggcattggcccagcgtgg
accaaagagtgcgtgctgccgggcggagatatcggcggcgatcgcgaagattacgcggcg
aagctgcgccgtcgctatccgttcctgagcgaatcgctggcgcgccattatgcgcgcacc
tacggcagcaacagcggcttgattctcggcgaagcgacgtcgctggccgatctcggcgag
aatttcggccacgaattctatgaggcggaactgaagtacctggtggaccacgaatgggtt
cgccgcgccgacgatgcgctgtggcgccgcaccaaagagggaatgtggcttaacgccgag
caacagtctcgcgttacccagtggttgacggcgtatatggaaaaacatccgttgtcgttg
gcgtcgtaa

DBGET integrated database retrieval system