KEGG   Citrobacter rodentium: ROD_44331Help
Entry
ROD_44331         CDS       T01145                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cro  Citrobacter rodentium
Pathway
cro00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01130  Biosynthesis of antibiotics
cro01230  Biosynthesis of amino acids
Module
cro_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ROD_44331 (aroK)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ROD_44331 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 TsaE APS_kinase ABC_tran AAA_7 AAA_5 AAA_17 Ploopntkinase3 RNA_helicase AAA_PrkA AAA_28 His_biosynth AAA_25 AAA_29 RsgA_GTPase PduV-EutP AAA_2 Mg_chelatase AAA_24 IstB_IS21 AAA_14
Motif
Other DBs
NCBI-ProteinID: CBG91128
UniProt: D2TLP8
LinkDB All DBs
Position
4688149..4688670
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEDGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVEAPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattctgatcaagagattgag
aaacgcaccggagctgatgtgggctgggtcttcgacgttgaaggcgaagacggcttccgc
gatcgtgaagagaaagtcattaacgaattgacggaaaaacagggtattgtgctggctacc
ggcggtggctctgttaaatcgcgtgaaacccgtaaccgtctttccgcgcgtggcgtcgtg
gtttacctcgaaacgaccatcgaaaaacaacttgcgcgtacgcagcgtgataaaaaacga
ccgctgttgcaggtagaagcgccgcctcgcgaggttctggaagcattggctaacgaacgc
aatccgctgtatgaagagattgccgacgtaaccattcgcaccgacgatcagagcgccaag
gtcgttgcaaaccagatcattcatatgctggaaagcaactga

DBGET integrated database retrieval system