KEGG   Citrobacter rodentium: ROD_45481
Entry
ROD_45481         CDS       T01145                                 
Symbol
acrF
Name
(GenBank) acriflavin resistance protein F
  KO
K18142  multidrug efflux pump
Organism
cro  Citrobacter rodentium
Module
cro_M00696  Multidrug resistance, efflux pump AcrEF-TolC
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_45481 (acrF)
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_45481 (acrF)
Transporters [BR:cro02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ROD_45481 (acrF)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    ROD_45481 (acrF)
SSDB
Motif
Pfam: ACR_tran SecD_SecF MMPL DUF3561
Other DBs
NCBI-ProteinID: CBG91244
UniProt: D2TNB4
LinkDB
Position
complement(4792467..4795580)
AA seq 1037 aa
MANFFIQRPIFAWVLAIILMLAGALAILQLPVAQYPTIAPPAVSVSATYPGADAQTVQDT
VTQVIEQNMNGIDNLMYMSSTSDSAGSVTITLTFQSGTDPDIAQVQVQNKLQLATPLLPQ
EVQQQGISVEKSSSSFLMVAGFVSDNPQTTQDDISDYVASNVKDSISRLNGVGDVQLFGA
QYAMRIWLDANLLNKYQLTPVDVINQLKVQNDQIAAGQLGGTPALPGQQLNASIIAQTRL
KDPDEFAKVTLRVNSDGSVVRLKDVARIELGGENYNVVARINGKPASGLGIKLATGANAL
DTATAIKAKLAELEPFFPQGMKVVYPYDTTPFVKISIHEVVKTLFEAIVLVFLVMYLFLQ
NIRATLIPTIAVPVVLLGTFAVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVM
MEDKLPPKEATEKSMSQIQGALVGIAMVLSAVFIPMAFFGGSTGAIYRQFSITIVSAMAL
SVLVALILTPALCATLLKPVSAEHHEKKGGFFGWFNARFDHSVNHYTNSVSGIVRKTGRY
LVVYLLIVVGMAVLFLRLPTSFLPEEDQGVFLTMIQLPAGATQERTQKVLDQVTHYYLNN
EKANVESVFTVNGFSFSGQGQNSGMAFVSLKPWEERSGEENSVESVIARATRAFSQIRDG
MVFPFNMPAIVELGTATGFDFELIDQGGLGHNALTQARNQLLGMVGQHPDLLVRVRPNGL
EDTAQFKLDVDQEKAQALGVSLSDINQTISAALGGYYVNDFIDRGRVKKVYVQADAKFRM
LPEDINNLYVRSANGEMVPFSTFSSARWVYGSPRLERYNGMPSMELLGEAAPGRSTGEAM
ALMENLASKLPNGIGYDWTGMSYQERLSGNQAPALYAISLIVVFLCLAALYESWSIPFSV
MLVVPLGVVGALLAASLRGLNNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGRGLI
EATLEASRMRLRPILMTSLAFILGVMPLVISRGAGSGAQNAVGTGVMGGMLTATLLAIFF
VPVFFVVVRRRFNKHQN
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggcaaacttttttattcaacgaccgatctttgcctgggtgctggccatcattctgatg
ctggcgggcgctctggcgattctgcaactccctgtcgcacagtatccgactatcgccccg
ccggcggtatccgtctctgccacctaccccggcgcagatgcgcaaacggtgcaggatacc
gttacccaggttatcgaacagaacatgaacggtatcgataacctgatgtatatgtcctcc
accagcgactcggcgggcagcgtgactatcaccttaaccttccagtccggcaccgacccg
gatatcgcgcaggttcaggtgcaaaacaagctgcagctggcgacgccgctgctgccgcag
gaagtgcagcaacagggcatcagcgtagagaaatcgagcagcagctttctgatggtggcg
gggttcgtctcagataatccgcagaccacccaggacgatatctccgactatgtcgcgtcg
aacgtgaaagactccatcagccgtctgaacggcgtgggggacgttcagctgtttggcgcc
cagtacgcaatgcgtatctggctggatgccaacctgctgaataaataccagcttaccccg
gtcgatgtcatcaatcagttaaaggtgcagaacgatcagatcgccgcgggccagctcggt
gggacaccggcattgccagggcagcagctgaacgcctcaatcatcgcgcagacgcgtctg
aaagatcctgacgaattcgccaaagtgacgctgcgtgtcaacagcgacggctccgttgtg
cggctgaaagatgtcgcccgcattgagcttggcggggaaaactataacgtcgtggcgcgc
attaacggaaaaccggcatccggtctgggaatcaagctggcgaccggagcaaacgcgctt
gatactgccaccgcgatcaaagccaaacttgccgaactggagcctttcttcccgcagggc
atgaaggtggtttacccttacgacaccacgccgtttgtgaagatctccattcatgaagtg
gtaaaaacgctgttcgaagcgatcgtgctggtctttcttgtcatgtacctgtttttgcag
aatatccgcgccactctcattcctaccatcgcggtgcccgtggtgttgctggggacgttt
gcggtgctggcggcattcggctattcgataaacaccctgacgatgttcggcatggtgctg
gccatcggcctgctggtggatgatgcgatcgtggtggtggaaaacgttgaacgcgtcatg
atggaagacaagttaccgcctaaagaggcgactgaaaaatcgatgtcgcagatccagggc
gcgctggtcggtatcgcgatggtcctgtccgccgtatttatcccgatggcctttttcggc
ggctcaacgggggcgatttaccgccagttttctatcaccatcgtatcggcaatggcgctt
tcggttctggtggcgctgatccttacccctgcgctttgcgcgacgctgctgaagcccgta
tccgcagaacaccatgagaaaaaaggggggttcttcggatggtttaacgccagattcgat
catagcgtcaaccattataccaacagcgtcagcggcattgtgcgcaagaccggacgctat
ctggtcgtctacctgctgatcgttgtcggcatggcagtattgttcttacgcttgccgacc
tccttcctgcctgaagaagatcagggggttttcctgaccatgattcagttgcctgccgga
gcaacgcaggaacggacgcaaaaggtgctggatcaggtgacgcattactacctgaataac
gaaaaggcgaacgttgaaagcgtcttcacggttaacggctttagcttcagcggtcagggg
cagaactcggggatggcgtttgtcagcctgaagccgtgggaggagcgcagcggtgaagaa
aacagcgtcgagtcggttatcgctcgcgcgacccgcgcattcagccagattcgtgatggg
atggtctttccctttaatatgcccgcaatcgttgagctgggtaccgctacgggcttcgac
tttgagctgattgaccagggcgggctgggacataacgcgttgacgcaggcgcggaaccag
ctgctgggcatggtcggacagcatcccgatctgctggtccgcgtgcgtccaaacggtctg
gaagataccgcgcagttcaagctggatgtcgaccaggagaaagcgcaggcgctgggtgtt
tctctttccgatatcaaccagactatctctgcggcgctgggcggctattacgtcaacgac
tttatcgatcgcggtcgcgtgaagaaggtatatgttcaggcagatgcgaaattccgtatg
ctgccagaggacattaataacctgtatgttcgcagcgcgaacggtgaaatggtgcccttc
tcaaccttcagttccgcgcgctgggtgtacggctcgccacgtctggaacgctacaacggt
atgccgtctatggagctgttgggcgaagccgcgcctggcagaagtaccggtgaagcgatg
gcattgatggaaaaccttgcctcgaaactgccgaatggcattggttatgactggacggga
atgtcttatcaggaacgtctgtctggtaaccaggcgccggcgctgtacgccatttcgctg
attgtcgttttcctgtgccttgcggcgctgtatgaaagctggtcgattcccttctcggtc
atgctggtcgtaccgctcggcgtggtgggcgcgcttctggctgcttcactacgtgggctg
aataacgacgtttatttccaggtcggactcttaaccaccattgggctgtcggctaaaaac
gccatcctgatagtggaatttgccaaggacctgatggacaaggaaggccgcgggctgatt
gaggcgacgctcgaagcctcccgtatgcgcctgcgtccgatactgatgacctctctcgcc
tttattctcggcgttatgccgctggttattagccggggagccggcagcggtgcgcagaac
gcggtaggaaccggggtaatgggaggaatgctgacggcgacgctgctggctatcttcttt
gtgccggtcttcttcgtcgtggtcagacgccgctttaataaacatcagaactaa

DBGET integrated database retrieval system