KEGG   Citrobacter rodentium: ROD_45511
Entry
ROD_45511         CDS       T01145                                 
Symbol
envR
Name
(GenBank) probable acref/envcd operon repressor (TetR-family transcriptional regulator)
  KO
K18140  TetR/AcrR family transcriptional regulator, acrEF/envCD operon repressor
Organism
cro  Citrobacter rodentium
Module
cro_M00696  Multidrug resistance, efflux pump AcrEF-TolC
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cro03000]
    ROD_45511 (envR)
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_45511 (envR)
Transcription factors [BR:cro03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    ROD_45511 (envR)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    ROD_45511 (envR)
SSDB
Motif
Pfam: TetR_C_2 TetR_N TetR_C_4 GntR N_Asn_amidohyd TetR_C_11
Other DBs
NCBI-ProteinID: CBG91247
UniProt: D2TNB7
LinkDB
Position
4798231..4798893
AA seq 220 aa
MAKKTRAEALKTRQHLIETAIVQFATRGVGNTTLNDIADAAQVTRGAIYWHFHNKTQLFN
EVWLQQPPLRDLIQERLSTSPAANPLQRLREKFIAALQYIAEIPRQQALLQILYHKCEFQ
DDMISEREIREKIGFHQQALRESLQESMAAGLIAKTVDLDMAVIIICGSFSGIVKNWLMN
PASYNLYQQAPALVDNVLTMLSPVGNLHQLIKTENAIGEI
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcaaagaaaaccagggccgaagccctcaaaacgcggcagcatttgattgagacggcg
atcgttcagtttgcgacgcggggggtaggcaacaccacgctcaatgatattgccgatgcg
gcccaggtcacgcgcggcgccatctactggcactttcacaacaagacgcagctctttaat
gaggtctggttgcaacagccgccgctgcgcgatcttattcaggaaaggctctccacgtcg
ccagccgctaatccattacaacggctgcgtgagaaattcattgccgcattgcaatacatc
gcggaaattccccgtcagcaggcgctgctgcaaattttatatcataaatgtgaatttcag
gatgacatgatatctgagcgtgaaatacgtgaaaaaataggctttcatcagcaggcgttg
cgcgagtcattacaggaaagtatggcggcaggtctgattgcgaagaccgtggatcttgat
atggctgttatcattatctgtggcagctttagcggtattgttaaaaactggctaatgaat
cccgccagttataatctttatcagcaggcgcccgcgctggtcgataatgtattaacaatg
ctaagtccggtggggaatctgcatcaattaataaaaacagagaatgcgattggggaaata
taa

DBGET integrated database retrieval system