KEGG   Citrobacter rodentium: ROD_48861
Entry
ROD_48861         CDS       T01145                                 
Symbol
nleH
Name
(GenBank) T3SS effector protein NleH
  KO
K16042  non-LEE-encoded effector NleH
Organism
cro  Citrobacter rodentium
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
SSDB
Other DBs
NCBI-ProteinID: CBG91572
UniProt: D2TRX7
LinkDB
Position
5152549..5153430
AA seq 293 aa
MLSPAPVNLGCSWNSLTRNLTSPDNAVLSSVRDAAACSDNGTQVKVGNRIYRVVVTDNKF
CVARENHSGCFTNMLHRLGWPKGEITRKIEAMLNTSPVNLAMERGSVHLKRPDLPPVDYM
QPELPRVDYNKSPVPGNVIGKGGNAVVYEDMDDTTKVLKMFTTSQNPEEVTNEVSCFNQY
YGSGSAEKIYDANGDIIGIRMNKINGESLFNIQSLPTQAEQAIYDMFDRLEQKRILFVDT
TETNVLYDRVRNEFNPIDISSYNISDVSWREGQIMQSYHGGKQDLIRVVLSRI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgttatcaccagctcctgtaaatttgggatgttcatggaattctttaaccagaaacctg
acttcgcctgataatgccgtcttatcctctgtaagggatgctgccgcttgctctgataat
gggacgcaagtaaaggtgggcaacagaatatatcgtgttgttgtaactgataataagttt
tgtgttgcaagggaaaaccatagtggttgttttactaatatgttacatagactgggatgg
cctaagggagagattaccagaaaaattgaggctatgctgaatacatcgccagtgaactta
gcgatggaaaggggttctgttcatttgaaaagacctgatttacctcctgtggattatatg
cagccagagttgccgagggtggactataacaagtcacccgttccgggtaatgtcattggt
aaaggtggtaacgccgtggtatatgaagatatggatgatacaacaaaagtcttgaagatg
tttactacatctcaaaaccctgaagaggtgacaaacgaagttagttgtttcaaccaatat
tatggttccgggagtgcagagaaaatatatgatgccaatggcgatataattggtattaga
atgaataaaataaatggagaatcgctttttaatattcagtcattaccaacacaggctgag
caggctatttatgatatgtttgacaggctggaacaaaaaagaattctttttgttgacaca
acagaaacaaatgttttatatgatcgtgtaagaaacgaatttaatccaatagatatatct
tcttataatatttctgatgtttcgtggagggaagggcaaataatgcaatcttatcatgga
ggaaagcaagatcttatcagagtggtattaagtagaatttaa

DBGET integrated database retrieval system