KEGG   Candidatus Carsonella ruddii PV (Pachypsylla venusta): CRP_013Help
Entry
CRP_013           CDS       T00403                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
crp  Candidatus Carsonella ruddii PV (Pachypsylla venusta)
Pathway
crp00030  Pentose phosphate pathway
crp01100  Metabolic pathways
crp01110  Biosynthesis of secondary metabolites
crp01120  Microbial metabolism in diverse environments
crp01130  Biosynthesis of antibiotics
crp01200  Carbon metabolism
crp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CRP_013
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CRP_013
Enzymes [BR:crp01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CRP_013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAF35044
UniProt: Q05FX7
LinkDB All DBs
Position
complement(9497..11407)
Genome map
AA seq 636 aa AA seqDB search
MLYNIINNIRLICIKSISKANSGHPGMPLGICDVFTIFFLNFYKINFNNLKSINKDKLII
SNGHGIIINYVLLYLYNVYKIKDLINFRRFNSNTPGHPEIGNFIDASTGPLGQGIGIGIG
IGLKSKKYKNKFNNFFNIFNNKVWIFCGDGCLMEGVSSESCSFCGCYNINNIILLYDSNN
ISIDGNVKNYFNENIKLKFISLNWNVIGPINGHCYFSIIKSLLKAKKSYFPTIIIYNTII
GFISPCKSYNENSHGNIFTKFEFLEILKNFTLTYDYVKKMFFDNKKKYLIYYKKKYKKYF
FELIRIFNNIIPKINFLKLYFKYYKINLNKSTRFVCSNILKNIYAINETFGGSADLTNSN
LTKNNFINSIRYKNFKNRYINYGVREFTMGLINYGLSSDKIGINYCSTFLVFSNYMYSAI
RNFCLSKLKNIFIFTHDSILVGEDGPSHQPIEQLHSIRIIPRNYIFRPYNYIELILCWIL
ILKFLNNCSSLILSRQNFKNNFIKIYNIKNIITGTYSCFYKKKIELIIVSNGSDLEICFE
CYFFLKKYFIIQIISLFCNKLFDKQKKIYKNKILNCKKIIFVESSNDDFWYKYKKYFTYV
LNIKKFGYSSNELELKKKTNLNKKFLIKLCLFVIKL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgttatataacataataaataatattagattaatttgtattaaatcaatttcaaaagct
aattctggacatcccggtatgcctcttggaatttgtgatgtatttacgatttttttttta
aatttttataaaataaattttaacaatttaaaatcaattaataaagataaacttataatt
tcaaatgggcatggaataattataaattatgtattactttatttatacaatgtatataaa
ataaaagatttaataaattttagaaggtttaattctaatacaccaggtcatcctgaaatt
ggaaattttattgatgcttcaactggtccattaggacaaggaattggaattggaattgga
attggtttaaaaagtaaaaagtataaaaataaatttaataatttttttaatatattcaat
aataaagtttggatattttgtggagatggatgtttaatggaaggagtgtcctccgaatca
tgttctttttgtggatgctataatattaacaatattatattattatatgatagtaataat
atttcaatagatggaaatgttaaaaattattttaatgaaaatattaagttaaaatttatt
tcattaaattggaatgttattggaccaataaatggacattgctatttttcaataattaaa
tctttattaaaagcaaaaaaaagttattttccaacaattataatttacaatactataata
ggatttatttctccatgtaaatcatataatgaaaattctcatggaaatatttttacaaaa
tttgaatttttagaaattttaaaaaattttacattaacatatgattatgttaaaaaaatg
ttttttgataataaaaaaaaatatttaatatactacaaaaaaaaatataaaaaatatttt
tttgagttaataagaatttttaataacattataccaaaaataaattttttaaaattatat
tttaaatactataaaataaatttaaataagtctactagatttgtttgttctaatatatta
aaaaatatatatgcaataaatgaaacatttggaggaagcgcagatttaacaaattctaac
ttaacaaaaaacaattttattaattctattagatataaaaattttaaaaatagatatata
aattatggagtacgagaatttacaatgggattaataaattacgggttatcttctgataaa
ataggaataaattattgttctacttttttagttttttcaaattatatgtatagtgcaata
agaaatttttgtttatctaaacttaaaaatatttttatatttacacatgattcaatttta
gttggtgaagatggaccatcacatcaaccaattgaacaattacattcaattagaataata
ccaagaaattatatatttagaccatataattatatagaattaattctatgttggatatta
attttgaaatttttaaataattgttcgtctctaattttatcaagacaaaattttaaaaac
aattttattaaaatatataatattaaaaatattataactggtacttattcatgtttttat
aaaaaaaaaatagaattaataattgtttctaatggatcagatttagaaatctgttttgaa
tgttattttttcttaaaaaaatattttattattcaaataatttcattattctgcaataaa
ttatttgataaacaaaaaaaaatatataaaaacaaaattttaaattgtaaaaaaataatt
tttgttgaatcttcaaatgatgatttttggtataaatataaaaaatactttacgtatgtg
ttaaacataaaaaaatttggatattctagtaacgaactagaactaaaaaaaaaaactaat
ttaaacaaaaaatttttaattaaactatgtttgtttgtaataaaattataa

DBGET integrated database retrieval system