KEGG   Candidatus Carsonella ruddii CE (Ctenarytaina eucalypti): A33U_014Help
Entry
A33U_014          CDS       T02194                                 

Gene name
metF
Definition
(GenBank) putative 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
cru  Candidatus Carsonella ruddii CE (Ctenarytaina eucalypti)
Pathway
cru00670  One carbon pool by folate
cru01100  Metabolic pathways
cru01120  Microbial metabolism in diverse environments
cru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cru00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A33U_014 (metF)
Enzymes [BR:cru01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     A33U_014 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AFP83489
UniProt: J7GSQ0
LinkDB All DBs
Position
12208..12918
Genome map
AA seq 236 aa AA seqDB search
MKQISFELFPTFNCINNLINKINIIKPYFISITCGKIDNYLFIKKNINFFKVNIVPHLIC
NEINNVLIKIILFIKLNIYNFLIITGDNYKSNSFYFVKKIRILFGHIIKIFSSIYSENHK
LSINLNKEILFIYKKNKIGINCYFSQFFFNYNIINYFLKIINKTGINKNIIIGIFPKKKI
SEILIFSNYCKVEISNWILKNYFFFNLKNYLLKNIKNKNFHFYTFNNIKNLNYYFK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaattagttttgaattatttcctacgtttaattgtattaataatttaattaat
aaaataaatataattaaaccttattttatttctataacttgtggaaaaatagataattac
ttatttataaaaaaaaatattaatttttttaaagttaatatagttcctcatttaatatgt
aatgaaattaataatgttttaataaaaataattttatttattaaattaaatatttataat
tttttaataataacaggagataattataaatcaaattctttttattttgtaaaaaaaata
agaattttatttggtcatataataaaaattttttcaagtatatattcagaaaatcataaa
ttatcaattaatttaaataaagaaatattatttatttataaaaaaaataaaataggaata
aattgttatttttctcaatttttttttaattataatattattaattattttttaaaaata
attaataaaactggtattaataaaaatattattataggaatttttccaaaaaaaaaaatt
agtgaaattttaattttttcaaattattgtaaagttgaaatttcaaattggatattaaaa
aattattttttttttaatttaaaaaattatttattaaaaaatataaaaaataaaaatttt
catttttatacatttaataatattaaaaatttaaattattattttaaataa

DBGET integrated database retrieval system