KEGG   Cryobacterium sp. LW097: B7495_01665Help
Entry
B7495_01665       CDS       T04908                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cry  Cryobacterium sp. LW097
Pathway
cry00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cry00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    B7495_01665
Enzymes [BR:cry01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     B7495_01665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Cellulase Glyco_hydro_14 Glyco_hydro_2_C DUF4434 DUF4350
Motif
Other DBs
NCBI-ProteinID: ASD20972
UniProt: A0A1Z3LFM9
LinkDB All DBs
Position
complement(348038..350068)
Genome map
AA seq 676 aa AA seqDB search
MSIHTPFPARAPATDRWLKGTTGLRYGGDYNPEQWPRETWLEDIKLMKQAGINLVSIAIF
AWGILEPREGEYDFSKLDDIFGLLHEAGIDIDLATPTAAPPAWFWKKYPDSRPVTRDGIT
LGNGSRGMVSPSSPDYRRAAAAITEQLARRYANHPALVLWHVHNEYGAPISDSYDDHSVA
AFRVWLQKRYGTLDTLNEKWGTTFWGQVYGEWDEIDAPRQSASVSNQAQRLDFHRFTSDA
LLECYINERDVIRRFTPDIPVTTNFMATNCLSPDYWKWAREVDIVANDHYLVAERADNHV
LLAMDADLSRSLAGGAPWILMEHSTGAVNWQPRNIAKRAGEMARNSLSHLARGADGILFF
QFRASRFGVEKFHSAMLPHAGAETRVWREVVALGETLGSLEAVRGSRVQARVALLWDTES
FWAQDFEWRPSAELGHRERLEAFYTALWNRNVSVDFAHPRDDLTGYDLVIAPSLYLAGPA
ASENLTGYVRDGGHLVVSYFSGIVDENDTVYPGAAPGALREVLGLTIPEFLPLHENETVT
LSDSRTGTAWTDDIEVSTAEVLARYVDGPAAGGPALTRNAFGAGSAWYISTKLTGTDLDS
LLLDVLNTAGIEAARGIDGVETIIRSTDTDEFLFVINHTDADQSWPASGTELLTQATVDG
TVLVPAGLTRVVHSVR
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccacaccccattccccgccagagcgcccgcgacagaccggtggttgaagggc
acgaccgggcttcgttacggtggcgactacaacccggagcagtggccccgcgagacctgg
ctggaagacatcaagctgatgaagcaggccgggatcaacctggtcagcatcgcgatcttc
gcctggggcatcctggagccacgcgagggcgaatacgacttcagcaagctcgacgacatc
ttcggcctgctgcacgaggccggcatcgacatcgacctcgccacgcccaccgcggccccg
ccggcctggttctggaagaaatacccggactcccggccggtcacccgggacggcatcacc
ctgggcaacggttcccgcggcatggtcagcccgtcgagccccgactaccgccgggccgcc
gcggccatcaccgagcagctcgcccgccggtatgcgaaccaccccgcccttgtgctctgg
cacgtgcacaacgagtacggtgcgcccatcagcgactcctacgacgaccactccgtcgcc
gccttcagggtctggctgcagaagcgttacggcacccttgacaccctcaatgagaagtgg
ggcaccaccttctggggacaggtgtacggcgagtgggacgagatcgacgcgccccgccag
tcggcctcggtgagcaaccaggcgcagcgcctggacttccaccggttcacctccgacgcg
ttgctcgagtgctacatcaacgagcgcgatgtcatccgccggttcaccccggacatcccc
gtgaccaccaacttcatggccaccaattgcctctcccccgactactggaagtgggccagg
gaggtggacatcgtcgccaacgaccactacctggtggccgaacgcgccgacaaccatgtg
ttgctggccatggatgccgacctgtcccggtcgctggccggcggcgccccgtggatcctg
atggagcactccaccggcgccgtcaactggcagccccgcaacatcgccaagcgtgccggc
gagatggcccgcaactcactctcccacctggcccgcggcgccgacggcatcctgttcttc
cagttccgggcctccaggttcggcgttgagaagttccactccgcgatgctgccgcacgcc
ggagccgagacccgggtctggcgcgaggtcgtcgccctgggcgaaaccctcgggtccctc
gaggccgtgcgcggctcccgcgtgcaggctcgcgtcgcgctgctctgggacaccgagtcg
ttctgggcacaggacttcgaatggcgcccgagcgccgaactgggccaccgcgaacgcctc
gaggccttctacacggcgctgtggaaccgcaacgtgtcggtggacttcgcgcatccgcgc
gacgacctcaccggctacgacctcgttatcgcgcccagcctctacctcgccggtccggcg
gcctcggagaacctcaccggctacgtgcgggacggcggccacctggtcgtctcctacttc
tccggcatcgtcgacgagaacgacaccgtctacccgggagccgcgcccggcgcgctccgg
gaggtgctcggcctgaccatcccggagttcctgcccctgcacgagaacgagaccgtcacc
ctcagcgattcccgcaccggaaccgcctggaccgacgacatcgaggtctccaccgctgag
gtgctggcccggtacgtggacggcccggccgccggcggaccggccctcacccgcaacgcg
ttcggtgcggggtcggcctggtacatctcgaccaagctcaccggaaccgacctggactcc
ctgctgctggacgtcctcaacaccgccggcatcgaggcggcccgcggcatcgacggcgtc
gagaccatcatccggtccaccgacaccgacgagttcctgttcgtgatcaaccacacggat
gccgaccagtcctggccggcctccggcaccgagttactcacccaggccacggtcgacggc
accgtcctggtaccggccggactcacccgcgtggtgcacagcgtccgatag

DBGET integrated database retrieval system