KEGG   Cryobacterium sp. LW097: B7495_09405Help
Entry
B7495_09405       CDS       T04908                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
cry  Cryobacterium sp. LW097
Pathway
cry00071  Fatty acid degradation
cry00280  Valine, leucine and isoleucine degradation
cry00281  Geraniol degradation
cry00362  Benzoate degradation
cry00592  alpha-Linolenic acid metabolism
cry01100  Metabolic pathways
cry01110  Biosynthesis of secondary metabolites
cry01120  Microbial metabolism in diverse environments
cry01130  Biosynthesis of antibiotics
cry01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cry00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B7495_09405
   00592 alpha-Linolenic acid metabolism
    B7495_09405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B7495_09405
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    B7495_09405
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B7495_09405
   00642 Ethylbenzene degradation
    B7495_09405
Enzymes [BR:cry01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     B7495_09405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ASD22279
LinkDB All DBs
Position
2036806..2038011
Genome map
AA seq 401 aa AA seqDB search
MAERTEVVFVDGVRTPFGRAGEKGMYWNTRADDLVVKAITGLMERNPNVPGERIDDVAIA
ATTQAGDQGLTLGRTAALLAGLPVSVPGFAIDRMCAGAMTSVTTMGAAIGFGAYDLAIAG
GVEHMGRHPMGAGVDPNPRFLSERLVSEDALNMGATAERIHDRFPEYTKDRSDRYALRSQ
QKVAAAYEAGKIQPDLVSVATRSAAGWGLATRDEAPRPETTLEGLAGLKTPFRPHGRITA
GNASGLNDGATACLLASGATAKELGLSVKMKLVSFAFAGVEPEVMGLGPVPSTEKALRKA
GLSITDIGLFELNEAFAVQVIAFLDHFGIDDDDPRVNEYGGAIAIGHPLASSGVRLMNQL
ASQFAEHPEVRYGLTAMCIGLGQGGTVIWENPHFNKKAAKR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagagaactgaagtcgtcttcgtggacggggttcgcaccccgttcggtcgtgcc
ggcgagaagggtatgtattggaatacccgcgccgacgacctggtcgtcaaggcgatcacc
ggactgatggaacgcaacccgaacgtgccgggcgaacgcatcgacgatgtcgccatcgcg
gcgaccacccaggccggtgaccaggggctgactctcggtcgcaccgcggccctgctggcg
ggcctgcccgtctcggtgccgggcttcgccatcgaccgcatgtgcgccggggcgatgacc
tcggtcaccaccatgggcgccgcgatcggtttcggcgcatacgacctcgccatcgccggc
ggagtcgaacacatgggtcgccacccgatgggcgccggggtcgacccgaacccccggttc
ctcagcgaacgcctggtcagtgaggacgccctcaacatgggcgcgaccgccgagcgcatc
cacgaccggttccccgagtacaccaaggaccgttccgaccggtatgccctgcgcagccag
cagaaggtcgcggccgcgtacgaagcgggcaagattcagccggacctggtgtccgtggca
acccgcagcgccgcgggctggggcctcgccacccgcgacgaggcgccgcgccccgagacc
accctcgagggcctcgccggcctgaagacgccgttccggccgcacggccgcatcaccgcc
ggcaacgcgtccggcctgaatgacggtgccaccgcctgccttctggccagcggtgccaca
gctaaggagctcgggctcagcgtgaagatgaagctcgtgagcttcgccttcgccggtgtc
gagcctgaggtgatggggctgggccccgtgccctccacggagaaggcgctgcgtaaggcc
ggtctgtcgatcaccgacatcggcctgttcgaactcaacgaggcgttcgcggtgcaggtg
atcgccttcctggaccacttcggcatcgacgacgacgatccccgcgtcaacgagtacggc
ggcgccatcgccatcgggcatccgctcgcatcatcgggcgtgcgcctgatgaaccagctc
gccagccagttcgccgaacaccccgaggtgcgttacggcctcacggccatgtgcataggc
ctcggccagggtggcactgtgatctgggaaaacccgcacttcaacaagaaggcagccaag
cgatga

DBGET integrated database retrieval system