KEGG   Cryobacterium sp. LW097: B7495_13000Help
Entry
B7495_13000       CDS       T04908                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cry  Cryobacterium sp. LW097
Pathway
cry00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cry00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    B7495_13000
Enzymes [BR:cry01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     B7495_13000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 Glyco_hydro_42C DUF4434 DUF4350 Glyco_hydro_35 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ASD24076
UniProt: A0A1Z3LPN0
LinkDB All DBs
Position
complement(2783640..2785703)
Genome map
AA seq 687 aa AA seqDB search
MTTPVATPAVTRQVTPTTPFVQNGIAYGCDYNPEQWGPEVWAEDVLLMQQAGVDLVAINI
FGWSALEPAPGEYDFTLLDTIVDLLHAHGIRVNLGTGTSSPPPWLTTLHPEILPQTEDGT
TRYPGGRQAWCPSSPVFREHALRLVEQVAKRFGDHPAVALWHVSNELGCHNALCYDDDTA
AAFRLWLEAKYGTIAALNAAWGTSFWSQRYTDWAEVHTPRLTLSSRNPGQVLDFQRFSSD
ELLGYYKAEEAVIRRHSSLPVTTNFMVAAHIRNLDYWSWASAVDVIANDHYLDHRLADPT
TELAFAADLTRGLAGGGAWLLMEQATSAVNWQPLNLAKTPGELTRNSLAHVARGAEAICF
FQWRASQQGSEKFHSALVPHAGTDTVLWREVVELGATLDRLDEIIGTRVVADAAILFSWE
AWWAGDGESRPSQSVTYLEQVHAAYTALHRLGVTVDIVSPDADLAGYNLVVVPALYLVTD
AQADNLSGYVAAGGHTLVTFYSGIVDEDDRVRLGGYPGAFRDLLGVRVEEFVPLRPGTTV
GLGAPIGLAAGAAGTLWTERLQLTGAEAVAHYTDGALPGVPALTRNRHGAGTAWYLATAP
DADTYRDVLRTIAGHAHVTAVGPEGDGLIEVIRRAAPGRSYRFIINHGDTDLEVSAAGVE
LITGADIARTLRVPAGAVRVLREDTAS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccagtagccaccccggccgtgacccgtcaggtcaccccgacgacaccgttc
gtgcagaacggcatcgcctacggctgtgactacaaccccgagcaatggggtccggaagtc
tgggccgaggacgtgctcctcatgcagcaggccggcgtcgacctcgtcgcgatcaacatc
ttcggctggtccgccctggagccggccccgggggagtacgacttcaccctgctcgacacc
atcgtggacctgctgcacgctcacggcatccgggtgaacctgggtaccggcacctcgtcg
ccgccgccgtggttgaccaccctgcaccccgagatcctgccgcagaccgaagacggcacc
acccgctaccccggcggtcgccaggcctggtgccccagctcgccggtgttccgcgagcac
gcgctgcgcctggtcgagcaggtcgccaagcgcttcggcgaccatcccgccgtggccctc
tggcacgtctccaacgaactcggctgccacaacgcgctctgctacgacgacgacaccgcc
gccgcgttccggctctggctcgaggccaagtacggcaccatcgccgccctcaacgccgcc
tggggcaccagcttctggagccagcgttacaccgactgggccgaggtgcacacccccagg
ctcaccctctccagccgcaaccccggacaggtgctcgacttccagcggttcagctccgac
gagctgctgggctactacaaggccgaagaagccgtcatccgccggcacagcagcctgccc
gtcacgacgaacttcatggtcgccgcgcacattcgcaacctcgattactggtcctgggca
tccgccgttgacgtgatcgccaacgaccactacctcgatcaccgcctcgccgaccccacc
accgagctggccttcgccgccgacctcacccgcggcctggccggcggcggcgcgtggctg
ctgatggagcaggccaccagcgccgtcaactggcagccgctgaacctggccaagacgccg
ggggagctgacccgcaactcgctggcccacgtggcccgcggcgccgaggcgatctgcttc
ttccagtggcgcgcctcccagcagggctcggagaagttccactccgcactggtgccgcac
gccggcaccgacaccgtgctctggcgtgaagtcgttgagctgggcgccaccctcgacagg
ctcgacgagatcatcggcacgcgcgtcgtcgcggatgccgcgatcctgttcagctgggag
gcctggtgggccggcgacggcgaatcccggccgtcgcagtcggtgacctacctcgagcag
gtgcacgccgcgtacaccgcgctgcacaggctcggcgtcaccgtcgacatcgtctccccg
gatgccgacctggccggctacaacctcgtcgtggtgcccgctctctacctggtcaccgac
gcccaggccgacaacctgtccggttacgtcgccgccggtggccacaccctggtcacgttc
tacagcggcatcgtcgacgaagacgacagggtgcgcctcggcggctaccccggcgcgttc
cgcgacctgctcggcgtgcgcgtcgaagagttcgtgccgctccgccccggcaccaccgtg
ggcctgggcgccccgatcgggctggcggccggtgccgccgggaccctgtggaccgaacgc
ctgcagctgaccggcgcggaggccgtggcgcactacaccgacggcgccctgcccggcgtg
cccgcgctcacccgcaaccggcacggcgccggcaccgcctggtacctggccaccgcgcca
gacgccgacacctaccgcgacgtgctccgcaccatcgccgggcacgctcacgtcacagcg
gtcggtccggagggcgacggcctcatcgaggtcatccgccgcgccgcgcccggccgctcc
taccgcttcatcatcaaccacggcgacaccgacctggaggtgagcgcggcgggggtcgag
ctcatcaccggcgccgacatcgcccgcaccctgcgcgtaccggccggagccgtacgcgtt
ctcagagaggacaccgcatcatga

DBGET integrated database retrieval system