KEGG   Cryobacterium sp. LW097: B7495_13880Help
Entry
B7495_13880       CDS       T04908                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cry  Cryobacterium sp. LW097
Pathway
cry00020  Citrate cycle (TCA cycle)
cry00480  Glutathione metabolism
cry01100  Metabolic pathways
cry01110  Biosynthesis of secondary metabolites
cry01120  Microbial metabolism in diverse environments
cry01130  Biosynthesis of antibiotics
cry01200  Carbon metabolism
cry01210  2-Oxocarboxylic acid metabolism
cry01230  Biosynthesis of amino acids
Module
cry_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cry_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B7495_13880
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B7495_13880
Enzymes [BR:cry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B7495_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: ASD23056
UniProt: A0A1Z3LLM8
LinkDB All DBs
Position
complement(2956714..2957928)
Genome map
AA seq 404 aa AA seqDB search
MSKIKVAGTVVELDGDEMTRIIWQAIKDSLIHPYLDIDLEYYDLSIQKRDETDDQITVDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWASPNGTIRNILGGTIFREPIIISNIPRL
VPGWNKPIIIGRHAFGDQYRATNFRFEGEGTLTMTFTPKDGGDPQQFEVFQAPGSGVAMG
MYNLDKSIIDFARASLNYGLERNYPVYLSTKNTILKAYDGRFKDIFQEIFDTEFKNRFEA
AGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLSTPDGS
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLSHRAKLDGNPALAEFAHTLED
VVVKTVESGKMTKDLALLVGPDQGYLTTEEFLAAIAENLQTRLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgaagatcaaggttgcaggtactgtcgtcgagcttgacggggacgagatgacccgc
atcatctggcaggccatcaaggactccctgattcacccgtacctcgacatcgacctcgag
tactacgacctctcgatccagaagcgtgacgagaccgacgaccagatcaccgtcgacgcg
gctcacgccatccagaagcacggcgtcggcgtcaagtgcgccaccatcaccccggacgag
gcccgggtcgaagaattcggcctgaagaagatgtgggcgtcgcccaacggcaccatccgc
aacatcctcggcggcaccatcttccgtgagccgatcatcatctccaacatcccgcgcctg
gtgccgggctggaacaagccgatcatcatcggccgccacgcgttcggcgaccagtaccgc
gccaccaacttccgtttcgagggcgaaggcaccctcaccatgaccttcaccccgaaggac
ggcggcgacccgcagcagttcgaggtcttccaggcgccgggcagcggtgtggccatgggc
atgtacaatctcgacaagtcgatcatcgacttcgcccgcgcctcgctcaactacggcctg
gagcgcaactacccggtctacctgtcgaccaagaacaccatcctcaaggcgtacgacggc
cggttcaaggacatcttccaggagatcttcgacaccgagttcaagaaccgcttcgaggcc
gccggcctcacctatgagcaccgcctgatcgacgacatggtcgcatcggcgatgaagtgg
gagggcggttacgtctgggcctgcaagaactacgacggcgacgtgcagtccgacaccgtc
gcgcagggcttcggctcgctcggcctgatgaccagcgtgctctccacccccgacggcagc
gtcgtcgaggccgaggccgcgcacggcaccgtgacccggcactaccgccagcaccagcag
ggcaagcccacctcgaccaacccgatcgcgtcgatctacgcctggacccgcggcttgtcg
caccgcgccaagctcgacggcaacccggcgctcgccgagttcgcgcacaccctcgaggat
gtggtcgtgaagaccgtcgagagcggcaagatgaccaaggacctcgcgctgttggtcggc
ccggaccagggctacctcaccaccgaggagttcctggccgcgatcgccgagaacctgcag
acccgcctggcctaa

DBGET integrated database retrieval system