KEGG   Cryobacterium sp. LW097: B7495_17790Help
Entry
B7495_17790       CDS       T04908                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cry  Cryobacterium sp. LW097
Pathway
cry00473  D-Alanine metabolism
cry00550  Peptidoglycan biosynthesis
cry01100  Metabolic pathways
cry01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cry00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B7495_17790
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B7495_17790
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B7495_17790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cry01011]
    B7495_17790
Enzymes [BR:cry01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B7495_17790
Peptidoglycan biosynthesis and degradation proteins [BR:cry01011]
 Precursor biosynthesis
  Amino acid ligase
   B7495_17790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_YheCD CPSase_L_D2 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: ASD23753
UniProt: A0A1Z3LNN1
LinkDB All DBs
Position
3781796..3782755
Genome map
AA seq 319 aa AA seqDB search
MSESEFLDIVVLAGGISHERDVSMRSGRRVADELTGLGHTVTVLDPQAGLLTELATRKPD
VIWPVLHGATGEDGALLSLLETTGIPHVGPRGTAAGLAWSKPTAKELVRRAGYATPTWIA
LSRETFRDLGAASVLEHLVTALGTPLVVKPAQGGSAQGVTIVDTAAGLPRAMVDAYTYDE
TALVETKIEGTELAVTVINTGAGPVALPAVEIVPVSGVFSFEARYNAGETLFFTPARIAP
DVAQRVAETAVAIHSLLGLAQLSRIDLMVDAEGVAWFLEANVLPGLTETSLAPQSIEASG
ESLGTVYAALARAASTSLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatcagagtttcttgacattgtggtgctcgcgggtggaatctcgcacgagcgc
gacgtctccatgcgcagtggccgccgggtggcagacgagctgaccgggctcggtcacacc
gtgaccgtgctcgacccgcaggcgggactcctcaccgagctagccacccgcaagcccgac
gtgatctggcccgttctgcacggcgcgaccggagaagacggtgccctgctctcactgctc
gagaccaccgggatcccgcacgtcggcccgcgtggcaccgcggcgggactggcctggtcc
aagcccaccgccaaggaacttgtacgtcgcgccggatacgccaccccgacctggatcgcc
ctctcacgtgagaccttccgcgacctcggtgccgccagtgtgcttgagcacctcgtgacc
gccctaggcacacccctggtcgtcaaacccgcccagggtggctctgctcagggtgtgacc
attgtcgacacggcagcgggtctcccccgcgccatggtcgatgcctacacctacgacgag
acggccctcgtcgagacgaagatcgaaggcaccgagcttgccgtcacggtcatcaacacc
ggtgccgggcctgtcgcactccccgccgttgaaatcgtgcccgtgagtggcgtcttcagc
ttcgaagctcggtacaacgccggcgaaacgctcttcttcacgccggcccgcatcgcaccg
gatgtggcccagcgggtggccgagaccgccgtggcgattcacagcctgctcgggttggcc
cagctttcccgcatcgacctgatggtcgacgccgagggggtcgcgtggttcctcgaggcg
aacgtcctgcccggactcaccgaaacctcactcgccccgcagtccattgaagcctccgga
gagtcactcggaactgtctatgcggccctcgctcgagcggcctccaccagcctgcagtag

DBGET integrated database retrieval system