KEGG   Chromobacterium rhizoryzae: D1345_06660Help
Entry
D1345_06660       CDS       T05688                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz00061  Fatty acid biosynthesis
crz00780  Biotin metabolism
crz01100  Metabolic pathways
crz01130  Biosynthesis of antibiotics
crz01212  Fatty acid metabolism
Module
crz_M00083  Fatty acid biosynthesis, elongation
crz_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:crz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D1345_06660 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    D1345_06660 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    D1345_06660 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:crz01004]
    D1345_06660 (fabI)
Enzymes [BR:crz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     D1345_06660 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     D1345_06660 (fabI)
Lipid biosynthesis proteins [BR:crz01004]
 Fatty acid synthase
  Component type
   D1345_06660 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AXT45878
LinkDB All DBs
Position
complement(1471179..1471967)
Genome map
AA seq 262 aa AA seqDB search
MGFLQGKKILITGMISNRSIAYGIAQACHREGAELAFTYVVDKLEDRVREMAADFGSKLV
FRCDVQNDEEINKLFADLGKEWDGLDGLVHAIAFAPRESLEGDFLDALSREAFQTAHDVS
AYSFPALAKAARPMMQGRNAALLTLSYLGAVRAIPNYNVMGLAKASLEASVRFMAASLGK
DGIRVNGISAGPIKTLAAAGISGFSKLLAMAAGQSCLRRNVTTEEVGNTAAFLLSNLSSG
ITGEITYVDAGFSINSLNVPEA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctgcaaggcaaaaagattctgattaccggcatgatctccaaccgctccatc
gcttacggcattgcccaggcctgtcatcgcgaaggtgcggaactggcgttcacctatgtg
gtggacaaactggaagaccgcgtgcgcgaaatggccgcggacttcggttccaagctggtt
ttccgctgcgacgtgcagaacgacgaagaaatcaataaattgttcgccgacctcggcaag
gaatgggacggcctggacggcctggtgcacgccatcgccttcgccccgcgcgaatcgctg
gaaggcgactttttggatgcgctgagccgcgaagctttccagaccgcgcacgatgtgtcc
gcctatagtttcccggcgctggccaaggccgcgcgcccgatgatgcaaggccgcaacgcc
gccctgctgaccctgtcctacttgggcgcggtgcgagccatcccgaattacaacgtgatg
ggcctggccaaagccagcctggaagcctcggtgcgcttcatggccgccagcctgggcaag
gacggtatccgcgtcaacggcatttccgcgggcccgatcaagaccctggccgccgccggc
atttccggcttctccaaactgctggccatggccgccggacagtcctgtctgcgccgcaac
gtcaccaccgaggaagtgggcaataccgccgctttcctgttgtccaatctgtcctccggc
attaccggtgaaatcacttatgtcgacgccggcttcagcatcaactcgctgaacgttccg
gaagcctga

DBGET integrated database retrieval system