KEGG   Chromobacterium rhizoryzae: D1345_12555Help
Entry
D1345_12555       CDS       T05688                                 

Gene name
ampH
Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
crz  Chromobacterium rhizoryzae
Brite
KEGG Orthology (KO) [BR:crz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:crz01002]
    D1345_12555 (ampH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:crz01011]
    D1345_12555 (ampH)
Enzymes [BR:crz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D1345_12555 (ampH)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     D1345_12555 (ampH)
Peptidases and inhibitors [BR:crz01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   D1345_12555 (ampH)
Peptidoglycan biosynthesis and degradation proteins [BR:crz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   D1345_12555 (ampH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase RdRP_4 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AXT46978
LinkDB All DBs
Position
2763038..2764150
Genome map
AA seq 370 aa AA seqDB search
MRTKGFICLALAALPALSQAAMPIAQLNQQAEKIFKDSQAVGMVMVVIDKQGSLQRFYGE
TRPGSRQTPDANSLLRIASLSKLMTSEVLASMALDQRLKLDDPLQKFAPAGARPAKALGG
QPITLLHLATHTSGFPRELPGVKPRDTPVFVWPDRQQRWRWLSKTKARFAPGQSAQYSNL
AYDYLADALAVAAGKPYPALLRDTVTGPLAMRDTTFSPSPAQCARLLRGVETSPCVNTSA
AIGSGGVYSTAADMQRWLQDLVRPQNEQRKRLYQQTFQMRYQRAELRSLAGMDVPGKADA
LGLGWVALRDQPNARPFLQKTAGGGGFFSYVAIDPQQQTAVWVALTRGKQTRYQAMSDGV
NQLLLALNRA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaaagggattcatctgcctggccctggccgccctgccggccttgagccaggcc
gccatgcccattgcccaactgaaccagcaagccgaaaaaatcttcaaggacagccaggcg
gtgggcatggtgatggtggtgatagacaagcaaggcagcctgcagcgcttttacggcgaa
acccgccccggcagccgccagacgccggacgccaactcgctgctgcgcatcgccagcctc
agcaaactgatgaccagcgaagtcctggcatccatggcgctggatcagcggctcaagctg
gacgacccgctgcaaaaattcgcgccggccggcgcccggccggccaaggccttgggcggc
cagcccatcaccctgctgcacctggccactcacaccagcggtttcccgcgcgagctgccg
ggcgtcaagccgcgcgacacgccggttttcgtctggcccgaccggcaacagcgctggcgc
tggctgtccaagaccaaggcccgcttcgctccgggacagagcgcgcaatactccaacctg
gcttacgactacctggccgacgcgctggccgtcgccgccggcaagccctacccggccttg
ctgcgcgacaccgtcaccggaccgctggccatgcgcgacaccaccttcagccccagcccc
gctcagtgcgcgcgcctgctgcgcggcgtggaaaccagtccctgcgtcaacaccagcgcg
gccataggcagcggcggcgtctattccaccgccgccgatatgcagcgctggctgcaagac
ctggtgcggccgcagaacgagcagcgcaagcgcctgtaccagcaaactttccagatgcgc
tatcagcgcgccgagctgcgcagcctcgccggcatggacgtgcccggcaaggccgacgcg
ctgggcctgggctgggtggccttgcgcgatcagcctaacgccaggcccttcctgcaaaaa
accgccggcggcggcggcttcttcagctatgtcgccatcgatccccagcagcagacggcg
gtatgggtggcgctgacccgcggcaagcaaacgcgctaccaggccatgagcgacggcgtc
aaccagttgctgctggcgctgaaccgcgcctag

DBGET integrated database retrieval system