KEGG   Chromobacterium rhizoryzae: D1345_19975Help
Entry
D1345_19975       CDS       T05688                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz00270  Cysteine and methionine metabolism
crz00920  Sulfur metabolism
crz01100  Metabolic pathways
crz01110  Biosynthesis of secondary metabolites
crz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:crz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    D1345_19975
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    D1345_19975
Enzymes [BR:crz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     D1345_19975
    2.3.1.46  homoserine O-succinyltransferase
     D1345_19975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: AXT49224
LinkDB All DBs
Position
4373513..4374655
Genome map
AA seq 380 aa AA seqDB search
MSDSHDSVGIVTAQTAVFDTPLPLNSGAILQGYQLRFETYGELNAAKSNAILICHALSGH
HHVAGRYQADDKAAGWWDNMVGPGKPIDTRRFFVVGVNNLGGCHGSTGPSSINPATGQPW
GSAFPVVTVSDWVYSQSRLADRLGIERWAAVIGGSLGGMQALQWSIDYPERIAHALVIAS
APKLSAQNIAFNDVARQAIITDPEFHGGDFYAHNALPRRGLRLARMLGHITYLSDDGMGA
KFGRMLRSGDYRFGYDVEFEIESYLRYQGDKFSDAFDANTYLLMTKALDYFDPAKSFGGD
LVAALKKASAQFLVASFTSDWRFSPERSRETVKALVAANRPVSYAEIESVHGHDAFLMTD
EPYVQLMRAYLDRVAREVQA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcccacgactccgtcggcatcgttacggctcaaaccgccgtgttcgatacc
cccttgccgctcaatagcggcgccatactgcaaggctaccagctgcgcttcgagacctat
ggcgaactcaatgccgccaagagcaacgccatcctgatctgccacgccctgtccggccac
catcatgtagccggccgctaccaggcggacgacaaggccgccggctggtgggacaatatg
gttggtcccggcaagcccatcgacacccgccgcttcttcgtggtcggcgtcaacaatctg
ggagggtgtcatggcagcaccggcccctccagcatcaatcccgccaccggccagccctgg
ggctccgcctttcccgtcgtcaccgtgtccgactgggtctacagccagtcgcgcttggcg
gaccgattgggcatagaacgctgggcggcggtgataggcggcagcctgggcggcatgcag
gccttgcaatggagcatcgactacccggagcgcattgcccacgcgctggtaatcgcatcc
gcccccaagctgtcggctcagaacatcgccttcaacgacgtggcgcgccaagccatcatc
accgaccccgaattccacggcggcgacttctacgcccataatgcgctgccgcggcgcggc
ctgcggctggcgcgcatgctcggtcacatcacctatctatccgacgacggcatgggcgcg
aaattcggccgcatgttgcgttccggagactatcgcttcggctacgacgtggagttcgag
atcgaatcctatctgcgttatcagggcgacaaattctccgacgccttcgacgccaatacc
tacctgctgatgaccaaggcgctggattacttcgacccggccaagagctttggcggagat
ctggtcgctgcgctgaaaaaggccagcgcccaattcctggtagccagcttcactagcgac
tggcgcttttcgccggagcgatcgcgcgaaaccgtcaaggcgctggtggccgccaaccgg
ccggtgtcttatgccgaaatcgagtccgtacacggccacgacgcctttttgatgaccgac
gaaccctatgtccaattgatgcgcgcctacctcgaccgcgtggcgcgggaggtgcaagca
tga

DBGET integrated database retrieval system