KEGG   Chromobacterium rhizoryzae: D1345_22820Help
Entry
D1345_22820       CDS       T05688                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
crz  Chromobacterium rhizoryzae
Pathway
crz00473  D-Alanine metabolism
crz01100  Metabolic pathways
crz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:crz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D1345_22820
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    D1345_22820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:crz01011]
    D1345_22820
Enzymes [BR:crz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     D1345_22820
Peptidoglycan biosynthesis and degradation proteins [BR:crz01011]
 Precursor biosynthesis
  Racemase
   D1345_22820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C HepII_C Sigma70_r3
Motif
Other DBs
NCBI-ProteinID: AXT48823
LinkDB All DBs
Position
4953099..4954328
Genome map
AA seq 409 aa AA seqDB search
MQFKKTLLALSLGLALAPALTMAAPPLMAANSGSTAEAARGNAWLEIDKAALDHNLAELK
RLVGADTKVCAILKADAYGHGIANVMPSIIAQGIPCVGIASNEEARVARASGYKGVVARV
RSATQEEIADGLQYDMQELVGNLELARQASALAKRQGKTLQIHLAINSAGISRNGVELAS
KQGRRDALAMLKLPNLQVVGIMTHFPVEDKADVQKGLAAFNKESAWLIKAGGLDRSKITL
HCANSFATLEVPEARLDMVRPGGAIFGDTVPSHTEYLRVMAFKSRVAAVNRYPAGNTVGY
DRTYTLKRESLLANIPVGYSDGYRRAFTNKAHVLVNGQRAPVVGKVSMNTLMVDVTEIPG
AKIGDEVVLFGKQGQAEISAGELEDINGALLADLYTVWGNSNPKLLVNR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcaagaaaacactgctggccttgtcgctgggcctggccttggcgcccgcgctg
accatggctgcgccgccgctgatggccgccaacagcggttccaccgcggaagccgcgcgc
ggcaacgcttggctggaaatcgataaggcggcgctggatcacaacctggccgagctcaag
cgcttggtgggtgcagacaccaaggtgtgcgccatcttgaaggcggacgcttatggccac
ggtatcgccaacgtgatgccgtccatcatcgcccagggtattccctgcgtgggcatcgcc
agcaatgaagaggcccgcgtggcccgcgccagcggctacaaaggcgtggttgcgcgcgtg
cgcagcgccacgcaggaagagatagccgacggcctgcaatacgatatgcaagagctggtg
ggcaatctggagttggcgcgtcaggcgtccgcgctggccaagcgccagggcaagacgctg
caaatccatctggccatcaactccgccggcatcagccgcaacggagtggagctggccagc
aagcaaggccgccgcgatgccctggccatgctcaagctgcctaatctgcaagtggtgggc
atcatgacccacttcccggtggaggataaggccgacgtgcaaaaaggcctggcggcgttc
aataaggaaagcgcttggctgatcaaggccggcgggctggaccgcagcaaaatcaccctg
cactgcgctaatagcttcgccacgctggaagtgccggaagcccgactggacatggtgcgc
ccgggcggcgccatcttcggcgacaccgtgcccagccacaccgagtatctgcgcgtgatg
gcgtttaaatcgcgagtggcggcggtcaaccgttatccggccggcaataccgtgggctat
gaccgtacttacaccctgaagcgcgagtccttgctggccaacatcccggtcgggtattcc
gacggttatcgtcgcgctttcaccaataaggcgcatgtgttggtcaatggtcagcgcgcg
ccggtggtgggcaaggtgtctatgaacaccttgatggtggatgtgaccgagattccggga
gccaagataggcgacgaggtggtgttgttcggcaagcagggccaggccgaaatcagcgcc
ggcgagctggaggacatcaacggcgccttgctggcggacctctacaccgtgtggggcaat
tccaatcccaaactgctggtgaaccgctaa

DBGET integrated database retrieval system