KEGG   Chromohalobacter salexigens: Csal_0359Help
Entry
Csal_0359         CDS       T00347                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
csa  Chromohalobacter salexigens
Brite
KEGG Orthology (KO) [BR:csa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Csal_0359
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Csal_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABE57721
UniProt: Q1R0N7
LinkDB All DBs
Position
402108..403208
Genome map
AA seq 366 aa AA seqDB search
MNDTLTPSPDIPQTMRAIVAYAPEDYRLEEVAVPEIGEKEILIKVEACGICAGDLKAYEG
APSFWGDETQPPYIKAPMIPGHEFVGHVVKLGPGVKGFDIGDRVISEQIVPCWDCRFCHR
GQYWMCEKHDVYGFQNNVNGGMAEYMKFPREAINHKLPENVPVENIVLTEPFSCSMHAVE
RAQIQLGDVVVLSGAGTLGLGMIGPAKKSGPAKLVVLDLHGERLELARKFGADVVLNPSE
EDVVQIVKDMTDGYGCDIYIEATGAPKSVEQGLAMLRKLGRFVEFSVFKDPVTVDWSIIS
DRKELDVLGAHLGPYCYPHVIEGIESGDFPTDGVVTHKLPLEDFHKGIELMRHDSSALKV
ILVPGA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatacgctcaccccgtcccccgatatcccgcagacgatgcgcgcgatcgtcgcg
tatgcgccggaggactatcgtctcgaagaagtcgcggtacccgagattggcgaaaaggag
attctgatcaaggtcgaggcctgcgggatctgcgccggtgatctcaaggcgtacgagggg
gcgccgagcttctggggcgacgagacgcagccgccgtacatcaaggcgcccatgatcccg
ggccacgagttcgtcggccatgtcgtcaagctggggcctggcgtcaagggattcgacatc
ggcgaccgcgtgatctccgagcagatcgtgccgtgctgggactgccgtttctgccatcgc
ggccagtactggatgtgcgaaaagcatgacgtctacggcttccagaacaacgtcaacggc
ggcatggccgagtacatgaagtttccccgagaggccatcaaccacaagctgccggaaaac
gttccggtggagaacatcgtgctgaccgagccgttctcctgctcgatgcatgcggtggag
cgggcacagattcaactgggcgacgtggtggtcctctccggcgccggcaccctggggctg
ggaatgatcggtcccgccaagaagtccggccctgccaagctggtggtgctggatctgcac
ggcgagcgcctggagctggcccgcaagttcggggccgatgtggtgctcaaccccagcgag
gaagacgtggtccagatcgtcaaggacatgaccgacggctatggctgcgacatctacatc
gaggccaccggcgcgcccaagtccgtggagcaggggttggcgatgctgcgcaagctggga
cgtttcgtggagttcagcgtgttcaaggatccggtcaccgtggactggagcatcatcagc
gatcgcaaggaactggacgtgctcggtgcgcacctggggccgtactgctatccgcacgtg
atcgagggcatcgagagcggcgatttccccaccgacggggtggtgacccacaagctgccg
ctggaggatttccacaagggcatcgagctgatgaggcacgacagcagcgcgctcaaggtc
atcctcgtgcccggcgcctga

DBGET integrated database retrieval system