KEGG   Chromohalobacter salexigens: Csal_2196Help
Entry
Csal_2196         CDS       T00347                                 

Definition
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00550  Peptidoglycan biosynthesis
csa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:csa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Csal_2196
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Csal_2196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csa01011]
    Csal_2196
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csa03036]
    Csal_2196
Enzymes [BR:csa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Csal_2196
Peptidoglycan biosynthesis and degradation proteins [BR:csa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Csal_2196
Chromosome and associated proteins [BR:csa03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Csal_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABE59547
UniProt: Q1QVG1
LinkDB All DBs
Position
complement(2472549..2474261)
Genome map
AA seq 570 aa AA seqDB search
MSRERSTTSSRRAPNTGPAGRGRYLFLLALIILALGALVGRITYLNVIDRDFLQNQGDSR
TLRVEPINAHRGMITDRNGDPLAISTPVVTLWANPQELPDDPIRLATLARSLNMNPDALE
SRLERYANHEFMYLRRRLTPEAAQPALALDMPGVYAKDEYKRYYPSGEVAAQLVGVTDID
DQGQEGLELAYNDYLSGQPGKRRVLKDRKGRLVRDLHLLQDAKPGGDLTLSIDLRLQYMA
YRELKKSVDEHDADGGSLVMMDARNGEVLAMANLPSYNPNNRTSIDVKGLRNQAITDAIE
PGSVMKPLAMSAALATDEIDPDTVIDTSPGWMVIDGYTISDFRNYGKLTPGGILLHSSNI
GMSHIALKLEKDTIWNQYRALGLGQAPETGFPGEGSGSLPSLYGLSQSARAAMAYGYGIS
LTPLQLASAYTAIANDGRRLHASLLKRPSAPLGDQVMSPNIAHELLGMLEQIVQPNAGGA
RAMVDGYRIAGKTGTVRKVTAGGYQQKAYRSLFAGIAPVSDPRIVTVVMIDNPKGDEYYG
GLVAAPVFGRVVGKALRLLDVPPDKQETSE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaacgctccaccacctcgtcgcgtcgtgcccccaacacggggcctgcgggg
cgcggacgttacctgttcctgctggcgctcatcatcctggccctgggcgcgctggtgggg
cgcatcacttacctcaacgtgatcgaccgcgatttcctgcagaatcagggggattcgcgc
accttgcgtgtggagcccatcaatgcccaccggggcatgatcaccgaccgtaacggcgat
cccttggccatctcgacgcccgtggtaacgctgtgggcgaacccccaggaacttcccgac
gatccgattcgcctcgccaccttggcgcgttccttgaacatgaatcccgatgccctcgag
tcgcgtctcgagcggtatgccaaccatgagttcatgtatctgcgccgacgcttgacgccg
gaggcggcgcagccggcactcgcgctcgacatgccgggcgtctatgccaaggacgagtac
aagcgttactacccgtcgggtgaggtggctgcccagctggtcggtgtgaccgacatcgac
gatcaggggcaggaggggctcgagctggcctacaacgactacctctccgggcagcccgga
aagcgtcgtgtgctcaaggaccgcaagggacgactcgtgcgcgatctgcacctgcttcag
gacgccaagcccggtggggacctgacgctgtcgatcgatctgcgcctgcagtacatggcc
tatcgcgagctgaagaaatcggtcgatgagcatgatgccgacggcggctcgctggtgatg
atggatgcgcgcaacggcgaggtgctggccatggccaacctgccttcctacaaccccaac
aatcgcacatccatcgatgtcaaaggcctgcgcaaccaggcgatcaccgacgccatcgag
ccggggtcggtgatgaagccgctggcgatgtcggctgcgctggccacggacgagatcgat
cccgatacggtcatcgatacctcgccgggctggatggtgatcgacggatacaccatcagc
gactttcgcaactacggaaagctcaccccggggggaatcctgcttcactcctcgaatatc
gggatgtcgcacatcgcgctgaagctggaaaaggacaccatctggaaccagtaccgggca
ctgggactggggcaagccccggaaaccggattccccggcgagggcagcggtagcctgcca
tcgctatacggtctgtcgcaaagcgctcgggcggccatggcctatggctacggcatttcg
ttgacgcccttgcagctcgccagtgcatacacggcgatcgccaacgacggccggcgcctg
cacgcatcgctgctgaagcgtccgtccgcgccgctcggcgatcaagtcatgtcgccgaac
atcgcgcacgagctgctgggcatgctggagcagatcgtccagcccaatgcggggggcgca
cgcgcgatggtggatggctatcggatcgcgggcaagaccggtacggtgcgcaaggtcacg
gccgggggctaccagcagaaagcctatcgcagtttgttcgccggcattgcgccggtctcc
gatccgcgcatcgtcacggtcgtgatgatcgacaatcccaagggagacgagtattacgga
ggcctggtggcggcgccggtctttggccgcgtggtgggcaaggcgctgcggcttctcgac
gtgccgccggataaacaggagacttccgagtga

DBGET integrated database retrieval system