KEGG   Chromohalobacter salexigens: Csal_2975Help
Entry
Csal_2975         CDS       T00347                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K08322  L-gulonate 5-dehydrogenase [EC:1.1.1.380]
Organism
csa  Chromohalobacter salexigens
Pathway
csa00040  Pentose and glucuronate interconversions
csa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Csal_2975
Enzymes [BR:csa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.380  L-gulonate 5-dehydrogenase
     Csal_2975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NADH_4Fe-4S AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABE60320
UniProt: Q1QT88
LinkDB All DBs
Position
3313207..3314229
Genome map
AA seq 340 aa AA seqDB search
MKAFEVRAPHDFGIVDIDAPQAAAGEVLVGVAFAGICGSDMHIIHGENAFVRFPRITGHE
FAGIVEDIGDGVEGLAVCDRVCIDPVISCGECYPCRIGRPNVCTRLAVIGVHRNGGFEQR
VSVPADNVHRLPANVGLDQAALVEPYTIAANVLERMQPHDGDALLILGAGVIGLTILQVA
RAKGLTDITVCDVIDDRLDAARSLGASHTVNGQRQDLEAVMSERSDGEGIPLIADAACVP
ALFPQLARIASPAGRIGLLGFNATPSDLVQLEVIKKELTIVGSRLNNRKFPDVIEMLASG
RLDASALVSHRLPFAEMGEAIHMIDHHPERVRKVLIELGA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattcgaggttcgcgccccccacgacttcggcatcgtcgacatcgatgccccg
caggccgccgccggcgaggtgctggtcggcgtcgccttcgccgggatctgtggctcggac
atgcacatcatccacggcgagaacgccttcgtgcggttcccacgcatcaccggccacgag
ttcgccggcatcgtcgaggacatcggcgacggcgtcgagggcctcgcggtgtgcgaccgg
gtgtgcatcgacccggtcatcagctgcggcgagtgctacccgtgccgcatcggccgtccc
aatgtctgtacccggctcgccgtgatcggcgtgcaccgcaacggcggcttcgagcagcgc
gtcagcgtgccggcggacaacgtgcaccgcctgccggcgaacgtcggtctcgaccaggcc
gcgctggtcgaaccgtacaccatcgcggccaatgtgctggagcgcatgcagccgcatgac
ggcgacgccctgctgatcctcggcgccggcgtgatcggcctgaccatcctgcaggtcgcc
cgcgccaaggggctcaccgacatcaccgtctgcgacgtcatcgacgaccgcctggatgcc
gcccgctcgctgggcgccagccacaccgtcaatggacaacgacaggacctggaggccgtg
atgagcgagcgcagcgacggcgagggcattccgctgatcgccgacgccgcctgcgtgccg
gccctgttcccgcagctggcgcgcatcgcctcaccggccgggcgcatcgggctgctgggt
ttcaacgccacgcccagcgacctggttcagctcgaggtgatcaagaaggagctgacgatc
gtcggctcgcgcctcaacaaccgcaagtttcccgacgtcatcgagatgctcgccagcggg
cggctcgatgcctcggcgctggtcagccaccggctgcccttcgccgagatgggtgaggcg
atccacatgatcgaccatcacccggaacgggtgcgcaaggtgctcatcgagctcggtgcc
tga

DBGET integrated database retrieval system