KEGG   Chlorocebus sabaeus (green monkey): 103215231Help
Entry
103215231         CDS       T04361                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00020  Citrate cycle (TCA cycle)
csab00190  Oxidative phosphorylation
csab01100  Metabolic pathways
csab01200  Carbon metabolism
csab04714  Thermogenesis
csab04932  Non-alcoholic fatty liver disease (NAFLD)
csab05010  Alzheimer disease
csab05012  Parkinson disease
csab05016  Huntington disease
Module
csab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csab_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103215231 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103215231 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103215231 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103215231 (SDHA)
   05012 Parkinson disease
    103215231 (SDHA)
   05016 Huntington disease
    103215231 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103215231 (SDHA)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103215231 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 Thi4 Succ_DH_flav_C GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 103215231
NCBI-ProteinID: XP_007959728
LinkDB All DBs
Position
4
AA seq 539 aa AA seqDB search
MSGVRRLSRLLSTRRLALAKAWPAVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCIE
DGSIHRIRAKNTVVATGLFCLPRGCGPEKDHVYLQLHHLPPEQLARRLPGISETAMIFAD
VDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGANRL
GANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELR
LSMQKVRAWTHSGVSRLAAYLALHWFCFFKNRFRGMQVQFVWMYREVVESGPQVRIDEYD
YSKPIQGQQKKPFEEHWRKHTLSYVDVSTGKVTLEYRPVIDKTLNEADCATVPPAIRSY
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggaggctgtcgcggctgctgagcactcggcgcctggcgctggccaag
gcgtggccagcagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttacaaagctgtttcctaccaggtcacacact
gttgcagcgcagggaggaatcaacgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacagagcaggctcccgccgccgtggtcgagctggaaaattatggcatgccattt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggaccggccactcacta
ttgcacaccttatatggaaggtctctgcgatatgacaccagctattttgtggagtatttt
gccttggatctcctgatggaggatggggagtgccgtggtgtcatcgcactgtgcatagag
gatgggtccatccatcgcataagagcaaagaacactgttgttgccacagggttgttctgt
cttcccagaggctgtggccctgagaaagatcacgtctacctgcagctgcaccacctgcct
ccggagcagctggccaggcgcctgcccggcatttcagagacagccatgatcttcgctgat
gtggacgtcacgaaggagccgatccctgtcctccccaccgtgcattataacatgggcggc
attcccaccaactacaaggggcaggtcctgaggcacgtgaatggccaggatcagattgtg
cccgggctgtacgcctgtggggaggccgcctgtgcctcggtacatggtgccaaccggctc
ggggcaaactctctcttggacctggtcgtctttggtcgggcatgtgccctgagcatcgaa
gagtcatgcaggcctggagataaagtccctccaattaaaccaaatgctggggaagaatct
gtcatgaatcttgacaaattgagatttgctgacggaagcataagaacgtcggaacttcga
ctcagcatgcagaaggtaagagcctggactcactctggagtgagcaggctggctgcatac
ctggccctgcactggttttgtttttttaaaaatagatttagggggatgcaggtgcagttt
gtgtggatgtaccgtgaggtggtggagtctgggcctcaggtgcggattgatgagtacgat
tactccaagcccatccaggggcaacagaagaagccctttgaggagcactggaggaagcac
accctgtcctacgtggacgtcagcactgggaaggtcactctggaatatagacccgtaatc
gacaaaactttgaacgaggctgactgtgccaccgtccccccagccattcgctcctactga

DBGET integrated database retrieval system