KEGG   Chlorocebus sabaeus (green monkey): 103215235Help
Entry
103215235         CDS       T04361                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00020  Citrate cycle (TCA cycle)
csab00190  Oxidative phosphorylation
csab01100  Metabolic pathways
csab01200  Carbon metabolism
csab04714  Thermogenesis
csab04932  Non-alcoholic fatty liver disease (NAFLD)
csab05010  Alzheimer disease
csab05012  Parkinson disease
csab05016  Huntington disease
Module
csab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csab_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103215235
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103215235
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103215235
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103215235
   05012 Parkinson disease
    103215235
   05016 Huntington disease
    103215235
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103215235
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103215235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO
Motif
Other DBs
NCBI-GeneID: 103215235
NCBI-ProteinID: XP_007959732
LinkDB All DBs
Position
4
AA seq 731 aa AA seqDB search
MSGVRRLSRLLSTRRLALAKAWPTVLQTGTXGFHFTIDGNKRASDKVSDSISAQYPVADH
EFDAVVVGAGGAGLRAAFGLSEAGFNTTCVTKLFPTRSHTVAVQGGINAALGNMEEDNWR
WHFYDTMKGSDXLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCYVADQTGPSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCIE
DGSVHRIRAKNTVVATGKKTTLLKNNLGSSSTDGARGLLCPFCDLTKQEVRTWAAVCSHC
CLLFPEVTGAPTSAHTSTGDSMAMITRADLPCQDLEFVQFHPTGIYGAGCLITEGCRGEG
GILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQ
LAMRLPGISETAMIFADVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGL
YACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDKFPPIKPNAGEESXMN
LDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRG
MVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQK
KPFEEHWRKHTLSYVDVSTGKVSVELVLTTAQNAHGPAQVRGLTLLMVNREEQAGFKSTP
DRFEAPLKQAL
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtcaggaggctgtcgcggctgctgagcactcggcgcctggcgctggccaag
gcgtggccaacagtgttgcaaacaggaacctgaggttttcacttcactattgatgggaac
aagagggcatctgataaagtttcagattccatttctgctcagtatccagtagcggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaataccacatgtgttacaaagctgtttcctaccaggtcacacact
gttgcagtgcagggaggaatcaacgctgctctggggaacatggaggaggacaactggagg
tggcatttctatgacactatgaagggctccgactgactgggggaccaggatgccatccac
tacatgacagagcaggctcccgccgccgtggtcgagctggaaaattacggcatgccattt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctatgtggctgatcagactggcccctcacta
ttgcacaccttatatggaaggtctctgcgatatgacaccagctattttgtggagtatttt
gccttggatctcctgatggaggatggggagtgccgtggtgtcatcgcactgtgcatagag
gacgggtccgtccatcgcataagagcaaagaacactgttgtcgccacaggcaaaaaaaca
accctactgaaaaacaacctaggtagcagctccactgatggtgcccgggggctgctgtgt
ccattctgtgatctcaccaaacaagaggtccggacgtgggccgctgtgtgcagtcactgc
tgtctgttgtttccagaggttacgggtgcacctacttctgcccacaccagcaccggtgac
agcatggccatgatcaccagggcagaccttccttgccaggacctagagtttgttcagttc
caccccacaggcatatatggtgccggttgtctcattacggaaggatgtcgtggagaggga
ggcattctcattaacagtcaaggcgaaaggtttatggagcgatacgcccctgtggcgaag
gacctggcgtctagagatgtggtgtctcggtcgatgactctggagatccgcgaaggaaga
ggctgtggccctgagaaagatcacgtctacctgcagctgcaccacctgcctccggagcag
ctggccatgcgcctgcccggcatttcagagacagccatgatcttcgctgatgtggacgtc
acgaaggagccgatccctgtcctccccaccgtgcattataacatgggcggcattcccacc
aactacaaggggcaggtcctgaggcacgtgaatggccaggatcagattgtgcccgggcta
tacgcctgtggggaggccgcctgtgcctcggtacatggtgccaaccggctcggggcaaac
tcgctcttggacctggttgtctttggtcgggcatgtgccctgagcatcgaagagtcatgc
aggcctggagataaattccctccaattaaaccaaatgctggggaagaatctntcatgaat
cttgacaaattgagatttgctgacggaagcataagaacgtcggaacttcgactcagcatg
cagaagtcaatgcaaaatcatgctgccgtgttccgtgtgggaagcgtgttgcaagaaggt
tgtgggaaaatcagcaagctctacggagacctgaagcacctgaagacgtttgaccgggga
atggtctggaacacggacctggtggagaccctggagctgcagaacctgatgctgtgtgcg
ctgcagaccatctacggagcagaggcgcggaaggagtcacggggcgcccacgccagggaa
gactacaaggtgcggattgatgagtacgattactccaagcccatccaggggcaacagaag
aagccctttgaggagcactggaggaagcacaccctgtcctacgtggacgtcagcactggg
aaggtcagtgtggagctggttctcaccacagcccaaaatgcgcacggccccgcccaggtt
cgcgggctgaccttgctgatggtgaaccgggaggagcaggccggatttaaatcaactcct
gacagatttgaggcaccactgaaacaggcactctga

DBGET integrated database retrieval system