KEGG   Chlorocebus sabaeus (green monkey): 103215687Help
Entry
103215687         CDS       T04361                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103215687 (TGM3)
Enzymes [BR:csab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103215687 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103215687
NCBI-ProteinID: XP_007960518
Ensembl: ENSCSAG00000010799
LinkDB All DBs
Position
2
AA seq 693 aa AA seqDB search
MAALGLQSINWQTAFNRQAHHTHKFSSRELILRRGQNFQVLMLMNKGLGSNERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGQYTMALQISSQ
GGVSSVKLGTFILLFNPWLNADSVFMGNHAEREEYVQEDAGIIYVGSTNRISMIGWNFGQ
FEEDILSICLSILDRSLNFRRDPATDVARRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRNWNGSVEILKDWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFSSA
HDTDRNLSVDVYYDAMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGIREGDVNLNFDMPFIFAEVNADRITWLYDGTTGRQMKNSVDTRTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERRVFQKALGKLKPNASFGATSSMGLEAEERE
SSIIGKFKVTGMLAVGKEVNLVLLLKNLSSDTKTVTVNMTAWTIVYNGTLVHEVWKDSAT
MSLDPEEEAEHPVKISYAQYEKYLKSDNMIRITAVCKVPDEPGVVVERDIILDNPTLTLE
VLDEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLLADFSCNKFHAIKAMLSIDVVE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctaggactccagagtatcaactggcagacggccttcaaccgacaagcgcat
cacacacacaagttctctagccgggagctcatcttgcggagaggccaaaacttccaggtc
ttaatgctcatgaacaaaggccttggctctaacgaaagactggagttcattgtctccaca
gggccttacccctccgagtcggccatgacaaaggctgtgtttccactctccaatggcagt
agcggtggctggagtgcggtgcttcaggccagcaatggcaatactctgactattagcatc
tccagtcctgccagcgcacccataggacagtatacaatggccctccagatctcctcccag
ggcggcgtctcctctgtgaaacttggaacgttcatactgctttttaacccctggctgaat
gcggatagcgtctttatgggtaaccatgctgagagagaagaatatgttcaggaagatgcc
ggtatcatctatgtgggaagcacaaatcgaattagcatgattggctggaactttggacag
tttgaagaagacattctgagcatctgcctctcaatcttggataggagtctgaatttccgc
cgtgaccctgctactgatgtggcccgcagaaatgaccccaaatacgttggccgggtgctg
agtgccatgatcaatagcaatgatgacaatggtgtgcttgctgggaattggagcggcact
tacacgggtggtcgtgacccaaggaactggaatggcagcgtggagatcctcaaggactgg
aagaaatctggcttcagcccagtccgatatggccagtgctgggtctttgctgggaccctc
aacacagcgctgcggtctttggggattccttcccgggtgatcaccaacttcagctcagct
catgacacagaccgaaatctcagtgtggatgtgtactacgatgccatgggaaaccccctg
gacaagggtagtgatagtgtatggaatttccatgtctggaatgaaggctggtttgtgagg
tctgacctgggtccctcgtacggtggatggcaggtgttggatgctaccccgcaggaaaga
agccaaggggtgttccagtgcggccccgcttcggtcattggtattcgagagggtgatgtg
aacctgaacttcgacatgccctttatcttcgcggaggtgaatgccgaccgcatcacctgg
ctgtatgatggcaccaccggcagacagatgaagaattccgtggacactcgcaccattggc
aggtacatcagcaccaaggcagtgggaagtaacgctcgcatggacgtcacggacaagtac
aagtacccagaaggctctgaccaggaaagacgagtgttccaaaaggctttggggaaactt
aaacccaatgcgtcatttggcgcaacgtcttcaatgggtttggaagcagaggaacgggag
tccagcatcatcgggaagttcaaggtcactggcatgctagcagtgggcaaagaagtcaac
ctggtcctactgctcaaaaacctgagcagtgatacgaagacagtgacagtgaacatgaca
gcctggaccattgtctacaatggcacacttgtacatgaagtgtggaaggactctgccaca
atgtccctggaccctgaggaagaggcagagcatcctgtaaagatctcgtacgctcagtat
gaaaagtacctgaagtccgacaacatgatccggatcacagccgtgtgcaaggtcccagat
gaacctggggtggtggtggagcgggacatcatcctggacaaccccaccttgaccctggag
gtgctggatgaggctcgtgtgcggaagcctgtgaacgtgcagatgctcttctccaatcca
ctggatgagccagtgagggactgtgtgctgatggtggagggaagcggcctgctgttgggt
aacctgaagatcgatgtgccgaccctacgtcccaaggagcggtcccgggtccgttttgag
atcctgcccacccggagtggcaccaagcaactgctcgccgacttctcctgcaacaagttc
catgcaatcaaggccatgctgtccattgacgtagtcgaatga

DBGET integrated database retrieval system