KEGG   Chlorocebus sabaeus (green monkey): 103215824Help
Entry
103215824         CDS       T04361                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00020  Citrate cycle (TCA cycle)
csab00310  Lysine degradation
csab00380  Tryptophan metabolism
csab01100  Metabolic pathways
csab01200  Carbon metabolism
Module
csab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csab_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103215824 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    103215824 (OGDHL)
   00380 Tryptophan metabolism
    103215824 (OGDHL)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     103215824 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 103215824
NCBI-ProteinID: XP_007960751
Ensembl: ENSCSAG00000010453
UniProt: A0A0D9RDJ1
LinkDB All DBs
Position
9
AA seq 1037 aa AA seqDB search
MSGQWLGRASSCLSPVVYASPSLPVSRMNQLRLLPSRLGAQAVRLLAAHEVPVFGWRSRS
SGPPATLPSSKGGGSSSYMEEMYFAWLENPRSVHKSWDNFFRKASEEASSGSAQPRPPSV
VRDSRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLI
TTIDKLAFYDLQEADLDKEFQLPTTTFIGGSENTLSLREIIRRLENTYCQHIGLEFMFIN
DVEQCQWIRQKFETPGVMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVM
IPALKTIIDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGD
VKYHLGMYHERINRVTNRNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSI
LVHGDAAFAGQGVVYETFHLSDLPSYTTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVAR
VVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLM
YKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLD
SPWPGFFNVDGEPKSMTCPATGIPEDVLTHIGSVASSVPLEDFKIHTGLSRILRGRADMT
KNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHL
WPDQAPYTVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQ
AKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNW
IVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPE
DGAAAQAPEQVQRLIFCTGKVYYDLVKERSSQGLEEKVAITRLEQISPFPFDLIKQEAEK
YPGAELAWCQEEHKNMGYYDYISPRFMTILRRTRPIWYVGRDPAAAPATGNRNTHLVSLK
KFLDTAFNLQAFEGKTF
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacagtggcttggtagagcctcttcctgtcttagtcctgtcgtttatgcctct
ccttcattgcctgtgtccagaatgaatcagctgaggctgttgccgtcccgtcttggggca
caggctgtgaggcttctggccgcacatgaagtcccagtgtttggctggcgcagcaggtcc
tccgggccaccggccaccctcccaagcagcaaaggtggaggcagctccagttacatggag
gagatgtacttcgcctggttggaaaacccccggagtgtccacaagtcctgggacaacttc
ttccggaaagccagtgaggaagcctcttctggctctgctcagccacggcccccttctgtt
gtccgtgacagcaggtctgcagtctcaagccggaccaagaccagcaagttagtggaggac
cacctggccgtgcagtccctgatccgggcctaccagatccgtggtcaccatgtggcccag
ctggaccccctgggcattctggatgcagacctggactcctttgtgccctcagacttgatc
acaaccattgataaactggccttctatgacctgcaggaggctgaccttgataaggagttc
cagctgccaacgaccaccttcatcgggggctctgaaaacaccctctctctgcgggagatc
attcgacgcctggagaacacttactgccagcacattggcctggagttcatgttcatcaac
gatgtggagcagtgccagtggatccggcagaagtttgagacccctggtgtgatgcagttc
tccagcgaggagaagcggacactgctggcccggctggtgcgctccatgaggtttgaagac
ttcctggcccggaagtggtcctcagagaagcggtttggcctggagggctgtgaagtgatg
attcctgccctcaagaccatcatcgacaaatccagcgagatggggattgagaatgtcatc
ttggggatgccacacaggggcaggctgaacgtgctggccaacgtgatccgcaaggacctg
gagcagatcttctgccagtttgaccccaagctggaggcggcagacgagggctccggggac
gtcaagtaccacctgggcatgtaccacgagaggatcaaccgtgtcaccaaccgaaacatc
actctgtcgctggtcgccaacccctcccacctggaggcagtggaccctgtggtgcagggg
aagacaaaggcagagcagttctaccgtggagacgcccagggcaagaaggtcatgtccatc
ctggttcatggggacgccgcctttgccggccagggcgtcgtatatgagaccttccacctg
agcgacctgccctcctacacaaccaacggtaccgtgcacgtcgtcgtcaacaaccagatt
ggattcaccacagacccccgaatggcccgttcctcaccataccccaccgatgtggcccgg
gtggtcaatgcgcccatcttccacgtgaacgccgatgacccagaggctgtgatatatgtg
tgcagtgtggcagccgaatggagaaacactttcaacaaagatgttgtcgtggacctggtc
tgttaccgccggcgcggccacaatgagatggatgagcccatgttcacccagccactcatg
tacaagcagatccacagacaggtgcctgtgctgaagaagtacgcagacaagctgattgcc
gagggcacggtcaccctgcaggagtttgaggaagaaattgcgaaatacgaccggatctgt
gaggaggcttatggcaggtccaaggataaaaagatcctgcatataaagcactggttggac
tccccctggcccggcttcttcaacgtagatggggagcccaagagcatgacatgcccagcc
acggggatccctgaggatgtgctcacccacatcggcagcgtggccagctctgtgcccctg
gaggactttaagatccacaccggcctctctcgcattctgcggggccgggcggacatgacc
aagaaccggacggtggactgggcgttggcagagtacatggcctttggctccctgctgaag
gagggcatccacgtgcggctcagcgggcaggatgtagagaggggcacgttcagtcaccgg
caccacgttctccatgaccaggaggttgaccgcaggacgtgtgtgcctatgaatcatctc
tggcctgaccaggccccgtacaccgtgtgcaacagctccctctcggagtacggagtcctg
ggctttgagctgggctatgccatggccagccccaatgccctggtcctctgggaggcccag
tttggggacttccacaacacggcccagtgcatcatcgaccagttcatcagcaccggccag
gccaagtgggtgcggcataacggcattgtgctgctgctgccccatggcatggaaggcatg
ggcccagagcactcgtctgcgaggcccgagaggttcctgcagatgagcaatgatgactcg
gatgcctaccccgcattcaccaaggacttcgaggtgagtcagctctatgactgcaactgg
atcgtggtcaactgctccacaccggccaactacttccacgtgctgcgccggcagatcctg
ctgcctttccgcaagccgctgattatcttcacacctaaatctctgctgaggcacccagag
gccaagtccagctttgaccaaatggtatccgggaccagcttccagcgggtgattcctgaa
gatggggctgcagcgcaggcccctgagcaggtgcagcggctcatcttctgcacgggaaag
gtgtactatgacctggtgaaggagcggagcagccagggcctggaggagaaggtggccatc
acgcgcctggagcagatctctccattcccctttgacctgatcaagcaggaggcagagaag
tacccaggtgcggagctggcctggtgtcaggaagagcacaagaacatgggctactatgac
tacatcagcccacgcttcatgaccatcctgaggcgcacgcggcccatatggtatgtcggc
cgggacccagcggctgcaccagccacaggaaacaggaacactcacctggtgtcactgaag
aagtttctggatactgccttcaatctccaggcctttgagggcaagacattttag

DBGET integrated database retrieval system