KEGG   Chlorocebus sabaeus (green monkey): 103216074Help
Entry
103216074         CDS       T04361                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00010  Glycolysis / Gluconeogenesis
csab00051  Fructose and mannose metabolism
csab00052  Galactose metabolism
csab00500  Starch and sucrose metabolism
csab00520  Amino sugar and nucleotide sugar metabolism
csab00524  Neomycin, kanamycin and gentamicin biosynthesis
csab01100  Metabolic pathways
csab01200  Carbon metabolism
csab04066  HIF-1 signaling pathway
csab04910  Insulin signaling pathway
csab04930  Type II diabetes mellitus
csab04973  Carbohydrate digestion and absorption
csab05230  Central carbon metabolism in cancer
Module
csab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csab_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103216074 (HK1)
   00051 Fructose and mannose metabolism
    103216074 (HK1)
   00052 Galactose metabolism
    103216074 (HK1)
   00500 Starch and sucrose metabolism
    103216074 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    103216074 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103216074 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    103216074 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103216074 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103216074 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    103216074 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103216074 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csab04131]
    103216074 (HK1)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103216074 (HK1)
Membrane trafficking [BR:csab04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103216074 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 103216074
NCBI-ProteinID: XP_007961410
Ensembl: ENSCSAG00000007913
LinkDB All DBs
Position
9
AA seq 921 aa AA seqDB search
MGQICQRESATAAKKPKSPPLNESEIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEIL
TRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FHLTKDMLLEVKKRMRAEMELGLRKQTHNNAAVKMLPSFVRSTPDGTENGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDRGLMCINMEWGAFGDNG
CLDDIRTQYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGA
GMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRTEASS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatctgccagcgagaatcggctacagcagctaaaaaaccaaaatctcctcca
cttaatgaaagtgagattgacaagtatctctatgccatgcggctgtccgatgaaactctc
atagatatcatgactcgcttcaagaaggagatgaagaatggcctctcccgggattttaat
ccaacagccacagtcaagatgttgccaacattcgtaagatccattcccgatggctctgaa
aagggagatttcattgccctggatcttggtgggtcttcctttcgaattctgcgggtgcaa
gtgaatcatgagaaaaaccagaatgttcacatggagtccgaggtttatgacaccccagag
aacatcgtgcacggcagtggaagccagctttttgatcatgttgctgagtgcctgggagat
ttcatggagaaaaggaagatcaaggacaagaagttacctgtgggattcacattttctttt
ccttgccaacaatccaaaatagatgaggccatcctgatcacctggacaaagcgatttaaa
gcaagtggagtggaaggagcagatgtggtcaagctgcttaacaaagctatcaaaaagcga
ggggactatgatgctaacattgtagctgtggtgaatgatacagtgggcaccatgatgacc
tgtggctatgacgaccagcagtgtgaagtcggcctgatcatcggtactggcaccaatgct
tgctacatggaggaactgaggcacattgatctggtggaaggagacgaggggaggatgtgt
atcaacacagaatggggagcctttggagatgatggatcattagaagacatccggacagag
tttgaccgggagattgaccggggatccctcaaccctggaaaacagctgtttgagaagatg
gtcagtggcatgtacttgggagagctggttcgactgatcctggtcaagatggccaaggag
ggcctcttgtttgaagggcggatcaccccggagctgctcaccagagggaagtttaacacc
agtgatgtgtcagccattgaaaagaataaggaaggcctccacaatgccaaagaaatcctg
acccgcctgggagtggagccgtccgatgatgactgtgtctcggtccagcacgtttgcacc
attgtctcgtttcgctcagccaacctggtggctgctacactgggcgccatcttgaaccgc
ctgcgtgataacaagggcacacccaggctgcggaccacggttggtgtcgacggatctctt
tacaagacgcacccacagtattcccggcgtttccacaagactctgaggcgcttggtgccg
gactccgatgtgcgcttcctcctctcagagagtggcagcggcaagggggctgccatggtg
acagcggtggcctaccgcttggccgagcagcaccggcaaatagaggagaccctggctcat
ttccacctcaccaaggacatgctgctggaggtgaagaagaggatgcgggctgagatggag
ctggggctgaggaagcagacgcacaacaatgccgcggttaagatgctgccctccttcgtc
cggagtacccctgacgggaccgagaatggtgacttcttggccctggatcttggaggaacc
aatttccgtgtgctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcac
aacaagatctacgccattcctattgaaatcatgcagggcactggggaagagctgtttgat
cacattgtctcctgcatctctgacttcctggactacatggggatcaaaggccctaggatg
cctctgggcttcacgttctcatttccctgccagcagacgagtctggacgcgggaatcttg
atcacgtggacaaagggttttaaggcaacagactgcgtgggccatgatgtagccacctta
ctaagggatgcgataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaac
gacacagtgggcaccatgatgacctgtgcttatgaggagcccacctgtgaggtcggactc
attgttgggactggcagcaatgcctgctacatggaggagatgaagaatgtggagatggtg
gagggagaccgggggctgatgtgcatcaacatggagtggggggcctttggggacaatggg
tgtctggatgatatcaggacacagtacgacagactggtggatgaatattccctaaatgcc
gggaaacaaaggtatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaac
atcttaattgacttcaccaagaagggattcctcttccgaggacagatctcagagccgctg
aagacccggggcatctttgagaccaagtttctctctcagatcgagagtgaccgattagca
ctgctccaggtccgggccatcctccagcagctgggtctgaatagcacctgcgatgacagt
atcctcgtcaagaccgtgtgcggggtggtgtccaggagggccgcgcagctgtgtggtgca
ggcatggctgcggtggtggataagatccgagagaacagaggactggaccgtctgaacgtg
actgtgggagtggacgggacgctctacaagcttcatccgcacttctccagaatcatgcac
cagacggtgaaggaactatcaccaaaatgtaacgtatccttcctcctgtctgaggatggc
agcggcaagggagccgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagc
agctaa

DBGET integrated database retrieval system