KEGG   Chlorocebus sabaeus (green monkey): 103216865Help
Entry
103216865         CDS       T04361                                 

Gene name
UGGT1
Definition
(RefSeq) UDP-glucose glycoprotein glucosyltransferase 1
  KO
K11718  UDP-glucose:glycoprotein glucosyltransferase [EC:2.4.1.-]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:csab00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103216865 (UGGT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csab01003]
    103216865 (UGGT1)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     103216865 (UGGT1)
Glycosyltransferases [BR:csab01003]
 Others
  Quality control
   103216865 (UGGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_24 Thioredoxin_15 Thioredoxin_14 Thioredoxin_12 UDP-g_GGTase Thioredoxin_13 Glyco_transf_8 Raf1_HTH
Motif
Other DBs
NCBI-GeneID: 103216865
NCBI-ProteinID: XP_007962764
Ensembl: ENSCSAG00000016881
UniProt: A0A0D9RWE1
LinkDB All DBs
Position
10
AA seq 1532 aa AA seqDB search
MGVLIVLTVLWLFSSVKADSKAITTSLTTKWFSTPLLLEASEFLAEDSQEKFWNFVEASQ
NIGSSDHHGTDYSYYHAILEAAFQFLSPLQQNLLKFCLSLRSYSATIQAFQQIAADEPPP
EGCNSFFSVHGKTTCESDTLETLLLTASERPKPLLFKGDHRYPSSNPESPVVIFYSEIGS
EEFSNFHRQLISKSNAGKINYVFRHYIFNPRKEPVYLSGYGVELAIKSTEYKAKDDTQVK
GTEVNTTVIGENDPIDEVQGFFFGKLRDLHPDLEGQLKELRKHLVESTNEMAPLKVWQLQ
DLSFQTAARILASPVELALVVMKDLSQNFPTKARAITKTAVSSELRTEVEENQKYFKGTL
GLQPGDSALFINGLHIDLDTQDIFSLFDVLRNEARVMEGLHRLGIEGLSLHNVLKLNIQP
SEADYAVDIRSPAISWVNNLEVDSRYNSWPSSLQELLRPTFPGVIRQIRKNLHNMVFIVD
PAHETTAELINIAEMFLSNHIPLRIGFIFVVNDSEDVDGMQDAGVAVLRAYNYVAREVDD
YHAFQTLTQIYNKVRTGEKVEVEHVVSVLEKKYPYVKVNSILGIDSAYDQNRKEARGYYE
QTGVGPLPLVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGEVPPDQDVVEY
IMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDYARFTILDSPGKTAAVANSMNYLTK
KGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYDAIKHQKSSNNVRISMINNPAKEIS
HENTQISRAIWAALQTQTSNAAKNFITKMAKEGAAEALAAGADIAEFSVGGMDFSLFKEV
FESSKMDFILSHAVYCRDVLKLKKGQRAVISNGRIIGPLEDSELFNQDDFHLLENIILKT
SGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKGDARIEYQFFEDRHSAIKLRPKEGE
TYFDVVAVVDPVTREAQRLAPLLLVLAQLINMNLRVFMNCQSKLSDMPLKSFYRYVLEPE
ISFTSDNSFAKGPIAKFLDMPQSPLFTLNLNTPESWMVESVRTPYDLDNIYLEEVDSIVA
AEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSANPVIVDTIVMANLGYFQLKANPGAWI
LRLRKGRSEDIYRIYSHDGTDSPPEADDVVIVLNNFKSKIIKVKVQKKADMVNEDLLSDG
TSENESGFWDSFKWGFTGGQKTEEMKQDKDDIINIFSVASGHLYERFLRIMMLSVLKNTK
TPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYKWPRWLHQQTEKQRIIWGYKILFL
DVLFPLVVDKFLFVDADQIVRTDLKELRDFSLDGAPYGYTPFCDSRREMDGYRFWKSGYW
ASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQV
PIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQL
QLRFQKEKETGTLYKEKTEEPSREGPQKREEL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atgggagttctgattgtactcactgttctgtggctgttctcctcagtaaaggccgactca
aaagccattacaacctctcttacaacaaaatggttttccactccactgttgttagaagcc
agtgagtttttagcagaagacagtcaagagaaattttggaattttgtagaagccagtcaa
aatattggatcatcagatcatcacggtactgattattcctattatcatgcaatactggaa
gctgcatttcagtttctgtcacctctccagcagaatttgttgaaattttgtctgtctctt
cgttcctactcagctacgatccaagccttccagcagatagcagctgatgaacctccacca
gaaggatgtaattcgtttttttccgtgcatggaaagacgacttgtgaatctgataccctg
gagactcttctactgacagcctctgaaagacccaaacctttattgttcaaaggagatcac
agatatccatcatctaatcctgaaagcccagtggtgattttctactctgagattggctct
gaggaattttctaattttcaccgccaacttatatcaaaaagcaatgcaggcaaaatcaat
tatgtattcagacattatatatttaatcccaggaaggagcctgtttacctctctggctat
ggtgtggaattggccattaagagcactgagtacaaggccaaggatgatactcaggtgaaa
ggaactgaggtaaacaccacagtgattggtgaaaatgatcctattgatgaggttcaggga
ttcttctttggaaaattaagagatctacaccccgacctggagggacagttgaaagagctc
agaaagcatcttgtggagagcaccaatgaaatggcacctttaaaagtttggcagttgcaa
gatctcagtttccagactgctgctcgaatcttggcttctcctgttgagttggctctggtt
gttatgaaggatcttagtcagaattttcctaccaaagccagagcaataacaaaaacagct
gtgagctcagaacttagaaccgaagtggaagagaatcagaagtatttcaagggaacttta
ggattacaacctggagattcagccctcttcatcaatggacttcacattgatttagataca
caggatatattcagtctgtttgatgtgttgaggaatgaagctcgggtcatggagggtctg
cataggttgggaatagaaggcctttctctgcataatgttttgaagctgaacatccagccc
tctgaggcagactatgcagtagacatccggagtcctgctatttcatgggtcaacaacctg
gaggttgatagcagatataattcgtggccttctagtttacaagagttgcttcgacccacc
tttcctggtgttattcggcagatcaggaaaaacttacataatatggttttcatagttgat
cctgcacatgagaccacagcagagttgattaacatagccgagatgttccttagtaatcat
ataccactaagaattggttttatctttgtggttaatgactctgaagatgttgatgggatg
caagatgctggagtggctgttcttagagcgtataattacgttgcccgagaggtggacgat
tatcatgccttccagactctgacacaaatctataacaaggtgaggactggagaaaaagtg
gaagttgaacatgtggtcagtgtcctggagaagaaatatccgtatgtaaaagtgaatagc
attttggggattgattctgcttatgatcagaatcggaaggaagcaagaggctactatgag
cagactggggttggacccctgccccttgtgctgttcaatggaatgccctttgaaagggaa
cagctagaccctgatgagttagaaaccatcacaatgcataaaatcctggagaccaccacc
ttcttccaaagagcagtgtacttgggtgaagtgccccctgatcaagacgtggtagagtat
atcatgaatcagccaaacgtcgttccacgaatcaattctaggattttgacagctgaacga
gactacctggatttaacagcgagtaataacttctttgtggatgattatgctagatttact
atcttggattccccaggcaagactgctgctgtagccaatagtatgaactatctgacaaag
aaaggaatgtcttccaaggaaatctatgatgattcttttattaggccagtcactttttgg
attgttggggattttgatagcccttctggacggcagttactgtatgatgccatcaaacat
cagaaatccagtaacaatgttagaataagcatgatcaataatcctgccaaagagataagc
cacgagaacactcagatctccagagcaatctgggcagctctccaaactcagacttccaac
gctgctaagaacttcatcaccaaaatggccaaggagggggctgcagaggccctggctgca
ggagctgacattgcggagttctctgttgggggaatggatttcagtctttttaaagaggtc
tttgagtcttccaaaatggatttcattttgtctcatgccgtgtactgcagggatgttctg
aagctgaagaagggacagagggcagtgatcagcaatggaaggatcattgggccactggag
gatagtgagctctttaatcaagacgatttccacctcctcgaaaatatcatcttaaaaacc
tcaggacagaaaataaaatctcatattcaacagcttcgggtagaagaagatgtggcaagt
gacttggtaatgaaggtggatgctctcctgtcagcacaacccaaaggagatgcaagaatc
gagtaccagttttttgaagacagacacagtgcaattaaactgaggccgaaggaaggggag
acgtactttgatgtcgtggctgtcgttgaccctgtcaccagagaagcacagagacttgct
cccttgctcttggttttggctcagctgataaacatgaatctgagagtatttatgaactgc
caatccaaactttccgacatgcctttaaaaagcttttaccgttatgtgttagaaccagag
atttctttcacttcagacaatagttttgctaagggtccaatagcaaaatttttggatatg
cctcagtctccactgttcactctgaacctgaacacacctgagagctggatggtagaatct
gtcagaacaccatatgatcttgacaatatttatttagaagaggtggacagtatagtggct
gctgagtatgagctggagtacctgttactggaaggtcattgctacgacatcaccacaggc
cagcctccacggggactgcagtttaccttaggaacttcagccaacccggtcatcgtggac
accattgttatggccaatctgggctactttcagctgaaagccaacccaggagcttggatc
ctcagacttagaaagggacgctctgaagatatttatagaatttacagccatgatggcacc
gattctccccctgaggctgatgatgtggtgatcgtcctcaacaacttcaaaagcaaaatt
attaaagtgaaggttcagaagaaggcagatatggtgaacgaagacttgctgagtgatgga
acgagtgagaatgaatctggattttgggattccttcaaatggggctttacaggaggacag
aagactgaggaaatgaagcaagataaagatgacataattaatattttctccgttgcatct
ggtcatctctacgaaagatttcttcgcataatgatgctatccgtgctgaagaataccaag
actcctgtgaaattctggttcttgaagaattacttgtcccccacatttaaggagtttata
ccttacatggcaaatgaatacaattttcagtatgagcttgttcagtacaaatggccccgg
tggcttcatcaacagactgaaaaacagcgtatcatctggggttacaagatcctcttcctg
gatgtacttttcccactagttgttgacaagttcctgtttgtggatgctgatcagattgtc
cgaacagatctgaaagagttgagagatttcagtttggatggtgctccttacggttacact
cccttctgtgacagccgaagagaaatggacggctacaggttctggaagtcagggtactgg
gccagtcatttagctgggcgaaagtatcatatcagtgcactatatgttgtggatctgaag
aagtttaggaaaatagctgctggtgacagactcaggggacagtaccaaggtctgagtcag
gaccctaacagcctttcaaatcttgatcaagatctgcccaataacatgattcatcaggtg
ccaattaaatccctccctcaagaatggctttggtgtgaaacgtggtgtgatgacgcctct
aagaaaagggcaaaaaccattgatttgtgtaataatccaatgaccaaagagcccaaactg
gaagcagccgtgcgaattgtcccagagtggcaggactacgaccaagagatcaaacagctc
cagctccgctttcagaaggagaaagaaacgggaacactgtacaaagagaagacagaagag
cccagccgagaaggtcctcagaaacgtgaagaattatga

DBGET integrated database retrieval system