KEGG   Chlorocebus sabaeus (green monkey): 103218385
Entry
103218385         CDS       T04361                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04020  Calcium signaling pathway
csab04022  cGMP-PKG signaling pathway
csab04024  cAMP signaling pathway
csab04260  Cardiac muscle contraction
csab04261  Adrenergic signaling in cardiomyocytes
csab04270  Vascular smooth muscle contraction
csab04713  Circadian entrainment
csab04720  Long-term potentiation
csab04723  Retrograde endocannabinoid signaling
csab04724  Glutamatergic synapse
csab04725  Cholinergic synapse
csab04726  Serotonergic synapse
csab04727  GABAergic synapse
csab04728  Dopaminergic synapse
csab04742  Taste transduction
csab04911  Insulin secretion
csab04912  GnRH signaling pathway
csab04921  Oxytocin signaling pathway
csab04924  Renin secretion
csab04925  Aldosterone synthesis and secretion
csab04927  Cortisol synthesis and secretion
csab04929  GnRH secretion
csab04930  Type II diabetes mellitus
csab04934  Cushing syndrome
csab04935  Growth hormone synthesis, secretion and action
csab05010  Alzheimer disease
csab05020  Prion disease
csab05022  Pathways of neurodegeneration - multiple diseases
csab05031  Amphetamine addiction
csab05410  Hypertrophic cardiomyopathy
csab05412  Arrhythmogenic right ventricular cardiomyopathy
csab05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103218385 (CACNA1C)
   04020 Calcium signaling pathway
    103218385 (CACNA1C)
   04024 cAMP signaling pathway
    103218385 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    103218385 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103218385 (CACNA1C)
   04929 GnRH secretion
    103218385 (CACNA1C)
   04912 GnRH signaling pathway
    103218385 (CACNA1C)
   04921 Oxytocin signaling pathway
    103218385 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    103218385 (CACNA1C)
   04924 Renin secretion
    103218385 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    103218385 (CACNA1C)
   04927 Cortisol synthesis and secretion
    103218385 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103218385 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    103218385 (CACNA1C)
   04270 Vascular smooth muscle contraction
    103218385 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    103218385 (CACNA1C)
   04727 GABAergic synapse
    103218385 (CACNA1C)
   04725 Cholinergic synapse
    103218385 (CACNA1C)
   04728 Dopaminergic synapse
    103218385 (CACNA1C)
   04726 Serotonergic synapse
    103218385 (CACNA1C)
   04720 Long-term potentiation
    103218385 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    103218385 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    103218385 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103218385 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103218385 (CACNA1C)
   05020 Prion disease
    103218385 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    103218385 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    103218385 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103218385 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103218385 (CACNA1C)
   05414 Dilated cardiomyopathy
    103218385 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103218385 (CACNA1C)
   04934 Cushing syndrome
    103218385 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csab04040]
    103218385 (CACNA1C)
Ion channels [BR:csab04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103218385 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 103218385
NCBI-ProteinID: XP_007965382
Ensembl: ENSCSAG00000011336
LinkDB
Position
11
AA seq 2205 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEMVEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNP
ETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVF
TSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSD
SSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPEL
LYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNC
ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQH
YGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVIL
SETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTE
INRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNSTEGESPCGSSFA
VFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEEGPSPSEAHQGAEDPFRPAGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEV
TVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDL
TAEEELDKAMKEAVSTASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKA
GSSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEG
HGPPLSPAIRVQEVAWKLSSNRCHSGESQTAMVGPEETSQDESYEVKMNHDAEACSEPSL
LSTDMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGD
ISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPTLR
LEGAESSEKLNSSFPSIHCGSWAETTPGGGDSSATRRARPVSLMVPSQAGAPGRQFHGSA
SSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGA
LLPFVNCRDAGQDRAGGEEDAGCARARGRLSEEELQDSRVYVSSL
NT seq 6618 nt   +upstreamnt  +downstreamnt
atggtcaatgagaatacgaggatgtacattccagaggaaaaccaccaaggttctaactat
gggagcccacgccccgcccatgccaacatgaatgccaatgcggccgcgggactggcccct
gagcacatccccaccccgggggccgccctgtcctggcaggcggccatcgacgcagcccgg
caggctaagctgatgggcagcgctggcaacgcgaccatctccacagtcagctccacgcag
cggaagcggcagcaatatgggaaacccaagaagcagggcagcaccacggccacacgcccg
ccccgagccctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagcatt
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattccctttccagaagatgattccaacgccactaattccaacctggaa
cgagtggaatatctctttctcataatttttacggtggaagcatttttaaaagtcatcgcc
tatggactcctctttcaccccaatgcctacctccgcaacggctggaatctgctcgatttt
atcattgtggttgtggggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gcgaacgctctcggagggaaaggggccggatttgatgtgaaagcgctgagggccttccgc
gtgctgcgccccctgcggctggtgtccggagtcccaagtctccaggtggtcctgaattcc
atcatcaaggccatggtccccctgctgcacatcgccctgctcgtgctgtttgtcatcatc
atctacgccatcatcggcctggagctcttcatggggaagatgcacaagacctgctacaac
caggagggcatagcagatgttccagcagaagatgacccttccccttgtgcgctggaaaca
ggccatgggcggcagtgccagaacggcacggtgtgcaagcctggctgggatggtcccaag
cacggcatcaccaactttgacaactttgccttcgccatgctcacggtgttccagtgcatc
accatggagggctggacggacgtgctgtactggatgcaggacgctatgggttatgagtta
ccctgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctggtt
ctcggtgtgttgagcggagagttttccaaagagagggagaaggccaaggcccggggagat
ttccagaagctgcgggagaagcagcagctagaagaggatctcaaaggctacctggactgg
atcactcaggctgaagacatcgatcccgagaacgaggacgaaggcatggatgaggagaag
ccccgaaacatgagcatgcccaccagtgagaccgagtctgtcaacaccgaaaacgtggct
ggaggtgacatcgagggagaaaactgcggggccaggctggcccaccggatctccaagtca
aagttcagccgctactggcgccggtggaatcggttctgcagaagaaagtgccgtgccgcg
gtcaagtctaatgtcttctactggctggtgattttcctggtgttcctcaacacgctcacc
attgcctctgagcactacaaccagccccactggctcacggaagtccaagacacggcgaac
aaggccctgctggccctcttcacggcagagatgctcctgaagatgtacagcctgggcctg
caggcctacttcgtgtccctcttcaaccgctttgactgcttcgtcgtgtgtggcggcatc
ctggagaccatcctggtagagaccaagatcatgtccccactgggcatctccgtgctccga
tgcgtccggttgctgaggatattcaagatcacgaggtactggaactccttgagcaacctg
gtggcatccttgctgaactctgtgcgctccatcgcctccctgctccttctcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttcaactttgat
gagatgcagacccggaggagcacatttgataacttcccccagtccctcctcactgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aactatatcctactgaatgtgttcttggccattgctgtggacaacctggctgacgctgag
agcctcacatctgcccaaaaggaggaggaagaggagaaggagagaaagaagctggccagg
actgccagcccagagaagaaacaagagatggtggagaagccggcagtggaggaatccaag
gaggagaagattgagctgaaatccatcacggctgacggagagtctccacccaccaccaag
atcaacatggatgacctccagcccaatgaaaatgaggataagagcccctaccccaaccca
gagactacaggagaagaggatgaggaggagccagagatgcctgtcggccctcgcccacgc
ccactctctgagcttcaccttaaggaaaaggcagtgcccatgccagaagccagcgcgttt
ttcatcttcagctctaacaacaggtttcgcctccagtgccaccgcattgtcaacgacacg
atcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctggctgctgag
gacccggtccagcacacctccttcaggaaccatattctgttttattttgatattgttttt
accaccattttcaccattgaaattgctctgaagatcctaggcaatgcagactatgtcttc
actagtatctttacattagaaattatccttaagatgactgcttatggggcttttctgcac
aagggctccttctgccggaactacttcaacatcctggacctgctggtggtcagcgtgtcc
ctcatctcctttggcatccagtccagtgcaatcaatgtcgtgaagatcttgcgagtcctg
cgagtactcaggcccctgagggctatcaacagggccaaggggctaaagcatgtggttcag
tgtgtgtttgtcgccatccggaccatcgggaacatcgtgattgtcaccaccctgctgcag
ttcatgttcgcctgcatcggggtccagctcttcaagggaaagctgtacacctgttcagac
agttccaagcagacagaggcggaatgcaagggcaactacatcacgtacaaagacggggag
gttgaccaccccatcatccaaccccgcagctgggagaacagcaagtttgactttgacaat
gttctggccgccatgatggccctcttcaccgtctccaccttcgaagggtggccagagctg
ctgtaccgctccatcgactcccacaccgaagacaagggtcccatctacaattaccgcgtg
gagatctccatcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatc
ttcgtgggcttcgtcatcgtcaccttccaggagcagggggagcaggagtacaagaactgt
gagctggacaagaaccagcgacagtgtgtggaatacgccctcaaggcccggcccctgcgg
aggtatatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactccacctac
ttcgagtacctgatgttcgtcctcatcctgctcaacaccatctgcctggccatgcagcac
tacggccagagctgcctgttcaaaatcgccatgaacatcctcaacatgctcttcactggc
ctcttcactgtggagatgatcctgaagctcattgccttcaaacccaagggttactttagt
gatccctggaatgtttttgacttcctcatcgtaattggcagcataattgacgtcattctc
agtgagactaatcactatttctgtgatgcatggaatacatttgacgccttgattgttgtg
ggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacccaatgctct
ccctctatgaacgcagaggaaaactcgcgcatctccatcaccttcttccgcctattccgg
gtcatgcgcctggtgaagctgctgagccgcggggagggcatccggacgctgctgtggacc
ttcatcaagtccttccaggccctgccctatgtggccctcctgatcgtgatgctgttcttc
atctacgcggtgatcgggatgcaggtgtttgggaaaattgccctgaatgataccacagag
atcaaccggaacaacaactttcagaccttcccccaggctgtgctgctcctcttcaggtgt
gccaccggggaggcctggcaggacatcatgctggcctgcatgccaggcaagaagtgtgcc
ccggagtccgagcccggcaacagcacggagggtgaatcaccctgtggcagcagctttgcc
gtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctctttgta
gctgtcatcatggacaactttgactacctgacaagggactggtccatccttggtccccac
cacctggatgagtttaaaagaatctgggcagagtatgaccctgaagccaagggtcgtatc
aaacacctggatgtggtgaccctcctccggcggattcagcccccactaggttttgggaag
ctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaatatgcctctgaacagc
gacgggacggtcatgttcaatgccaccctgtttgccctggtcaggacagccctgaggatc
aaaacagaagagggacccagcccatcagaggcccaccaaggggctgaggatcctttccgc
cctgcagggaacctcgaacaggccaatgaggagctgcgggccatcatcaagaagatctgg
aagcggaccagcatgaagctgctggaccaggtggtgcctcctgcaggcgatgatgaggtc
accgttggcaagttctacgccacattcctgatccaggagtacttccggaagttcaagaag
cgcaaagagcagggccttgtgggcaaaccctcccagaggaacgcgctgtctctgcaggct
ggcttgcgcacgctgcacgacatcgggcctgagatccgacgggccatctctggagatctc
accgctgaggaggagctggacaaggccatgaaggaggctgtgtccactgcttctgaagat
gacatcttcaggagggccggtggcctgttcggcaaccacgtcagctactaccaaagcgac
ggccggagcgccttcccccagaccttcaccactcagcgcccactgcacatcaacaaggcg
ggcagcagccagggcgacactgagtcgccatcccacgagaagctggtggactccaccttc
acccccagcagctactcgtccaccggctccaacgccaacatcaacaatgccaacaacacc
gccctgggtcgcctccctcgccccgccggctaccccagcacggtcagcactgtggagggc
catgggccccccttgtcccctgccatccgggtgcaggaggtggcgtggaagctcagctcc
aacaggtgccactccggggagagccagacagccatggtgggtccggaggagacgtctcag
gatgagtcctatgaagtgaagatgaaccatgacgcggaggcctgcagtgagcccagcctg
ctctccacagacatgctgtcctaccaggatgacgaaaatcggcaactgacgctcccagag
gaggacaagagggacatccggcaatccccaaagaggggtttcctccgctctgcctcacta
ggtcgaagggcctccttccacctggaatgtctgaagcgacagaaggaccgagggggagac
atctctcagaagacagtcctgcccttgcatctggttcatcatcaggcactggcagtggca
ggcctgagccccctcctccagagaagccattcccctgcctcattccccaggccttttgcc
acccccccggccacacctggcagccgaggctggccgccacagcccatccccaccctgcgg
ctggagggcgccgagtccagtgagaaactcaacagcagcttcccgtccatccactgcggc
tcctgggctgagaccacccccggtggcggggacagcagcgccacccggagagcccggccc
gtctccctcatggtgcccagccaggctggggccccggggaggcagttccacggcagtgcc
agcagcctggtggaagcggtcttgatttctgaaggactggggcagttcgctcaagatccc
aagttcatcgaggtcaccacccaggagctggcggacgcctgcgacatgaccatagaggag
atggagagcgcggccgacaacatcctcagcgggggcgccccacagagccccaatggcgcc
ctcttaccctttgtgaactgcagggacgcggggcaggaccgagccgggggcgaagaggac
gcgggctgtgcgcgcgcgcgggggcgcctgagcgaggaggagctccaggacagcagggtc
tacgtcagcagcctgtag

DBGET integrated database retrieval system