KEGG   Chlorocebus sabaeus (green monkey): 103218647
Entry
103218647         CDS       T04361                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01522  Endocrine resistance
csab04012  ErbB signaling pathway
csab04066  HIF-1 signaling pathway
csab04068  FoxO signaling pathway
csab04110  Cell cycle
csab04151  PI3K-Akt signaling pathway
csab04933  AGE-RAGE signaling pathway in diabetic complications
csab04934  Cushing syndrome
csab05162  Measles
csab05165  Human papillomavirus infection
csab05169  Epstein-Barr virus infection
csab05200  Pathways in cancer
csab05202  Transcriptional misregulation in cancer
csab05203  Viral carcinogenesis
csab05206  MicroRNAs in cancer
csab05215  Prostate cancer
csab05220  Chronic myeloid leukemia
csab05222  Small cell lung cancer
csab05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103218647 (CDKN1B)
   04066 HIF-1 signaling pathway
    103218647 (CDKN1B)
   04068 FoxO signaling pathway
    103218647 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    103218647 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103218647 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103218647 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    103218647 (CDKN1B)
   05206 MicroRNAs in cancer
    103218647 (CDKN1B)
   05203 Viral carcinogenesis
    103218647 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    103218647 (CDKN1B)
   05220 Chronic myeloid leukemia
    103218647 (CDKN1B)
   05215 Prostate cancer
    103218647 (CDKN1B)
   05222 Small cell lung cancer
    103218647 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103218647 (CDKN1B)
   04934 Cushing syndrome
    103218647 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    103218647 (CDKN1B)
   05169 Epstein-Barr virus infection
    103218647 (CDKN1B)
   05165 Human papillomavirus infection
    103218647 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103218647 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103218647
NCBI-ProteinID: XP_007965895
Ensembl: ENSCSAG00000008587
LinkDB
Position
11
AA seq 206 aa
MSNVRVSNGSPSLERMDARQGEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHRPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANPEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDGNNPFPTNDSSTQNKRANRTEE
NVSDGSPNAGSVEQTPKKPGLRRRQT
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctagagcggatggacgccaggcag
ggggagcaccccaagccctcggcctgcaggaacctctttggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacagacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcctgagttctactatagacccccgcggccccccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaaccctgaggacacgcatttggtagacccaaagactgatccgtcggacagc
cagacggggttagcggagcagtgcgcaggaataaggaagcgacctgcaaccgacggtaat
aaccccttcccaaccaacgattcttccactcaaaacaaaagagccaacagaacagaagaa
aatgtttcagacggttccccaaatgccggttctgtggagcagacgcccaagaagcctggc
ctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system