KEGG   Chlorocebus sabaeus (green monkey): 103218736Help
Entry
103218736         CDS       T04361                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00500  Starch and sucrose metabolism
csab01100  Metabolic pathways
csab04151  PI3K-Akt signaling pathway
csab04152  AMPK signaling pathway
csab04910  Insulin signaling pathway
csab04922  Glucagon signaling pathway
csab04931  Insulin resistance
Module
csab_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103218736 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103218736 (GYS2)
   04152 AMPK signaling pathway
    103218736 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103218736 (GYS2)
   04922 Glucagon signaling pathway
    103218736 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    103218736 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csab01003]
    103218736 (GYS2)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103218736 (GYS2)
Glycosyltransferases [BR:csab01003]
 Polysaccharide
  Storage polysaccharide
   103218736 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 103218736
NCBI-ProteinID: XP_007966064
Ensembl: ENSCSAG00000007951
UniProt: A0A0D9R6H1
LinkDB All DBs
Position
11
AA seq 703 aa AA seqDB search
MLRGRALSVTSLSGLPRWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GFSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVVAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVE
DEVEDERYDEEKEAERDRLNIKSPFALSHVPRGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgagccctgtctgtaacatccctgagtgggcttccccggtgggaagtc
gaagaacttcctgtggaggagttactgctctttgaagttgcttgggaggtgaccaataaa
gttggaggcatctatactgtgattcagacaaaggccaaaacaacggcagatgaatgggga
gacaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacaa
tgtgaacctgtaaatgatgctgtcagaagagcagtggacgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtactttttgacata
ggcttttcagcttggaatctggataggtggaagggtgacctctgggaagcatgcagtgtc
ggcattccttatcatgaccgagaagccaatgatatgctaatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcacgcagatggtaaacatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgagccaggaaacttcctattgccaca
atatttacaacccatgctacactactcgggaggtatctctgtgcagcaaatattgatttc
tacaaccatctcgataagtttaacatagacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgagcctccgttcattgcgctcatgtgttcaccacggtttctgaa
ataacagcaatagaggccgaacatatgctgaagagaaagcctgatgtagttactccaaat
ggcttgaatgttaagaaattttcagcagttcatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggctaaatttcctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcatcatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacaactgtgggacattgcacattctgtgaaggaaaagttt
ggaaaaaaactctatgatgcattattaagaggagaaattcctgacatgaacaatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgatcgatgactccaccgaccccatcctcagcaccatt
agacggatcggacttttcaacaaccgtacagacagagtcaaggtgattttgcacccggag
tttctgtcctccaccagtcccctactacccatggactatgaagagtttgtcagaggttgt
caccttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcacc
gtgatgggtatccccagcgtgaccacgaatctctccgggtttggctgtttcatgcaggag
catgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactcagtttctttatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccagacacctgacattaagcagagcttttccagataaa
ttccatgtggaactaacatcaccaccaacgacagaaggatttaaatatcccaggccttcc
tcagtaccaccttctccttcagggtctcaggcctccagtcctcagagcagtgatgtggaa
gacgaagtggaggatgagagatacgatgaggaaaaggaggctgaaagggatcggttaaat
atcaagtcaccatttgcactgagccacgttcctcgtgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system