KEGG   Chlorocebus sabaeus (green monkey): 103218890Help
Entry
103218890         CDS       T04361                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00590  Arachidonic acid metabolism
csab01100  Metabolic pathways
csab04611  Platelet activation
csab04726  Serotonergic synapse
csab04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103218890 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103218890 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103218890 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    103218890 (PTGS1)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103218890 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 103218890
NCBI-ProteinID: XP_007966350
Ensembl: ENSCSAG00000013388
LinkDB All DBs
Position
12
AA seq 658 aa AA seqDB search
MPWSGLGRGSKRAAEVTAGGRGGVEPGEGWRGEGPELRAVCEAHAQEPALCVPHPSSRAM
SRSLLLQFLLLLLLLPQLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRT
GYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIRELLMRLVLTVRSN
LIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFL
LRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQY
QLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYA
TLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIRIVIEEYVQQLSGYFLQLKFD
PELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEAL
VDAFSRQSAGRIGGGRNMDHHVLHVAVDVITESREMRLQPFNEYRKRFGMKPYTSFQELV
GEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSP
EYWKPSTFGGEMGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgccttggtcggggctgggcagaggaagtaagcgggcggctgaggtgacagctggaggg
aggggcggggtggagccgggagaagggtggagaggggaggggccggagctccgggcagtg
tgcgaggcgcacgcacaggagcctgcactctgcgtcccgcaccccagcagccgcgccatg
agccgaagtctcttgctccagttcttgctgctcctgcttctgctgccgcagctcccggtc
ctgctcgcggacccaggggcgcccacgccagtgaatccctgttgttactatccatgccag
caccagggcatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgcacg
ggctattccggccccaactgcaccatccctggcctgtggacctggctccgtaattcattg
cggcccagcccctctttcacccacttcctgctcacacacgggcgctggttctgggagttt
gtcaatgccaccttcatccgagagctgctcatgcgcctggtactcacagtgcgctccaac
cttatccccagtccccccacctacaactcagcacatgactacatcagctgggagtctttc
tccaacgtgagctattacactcgtattctgccctctgtgcctaaagactgccccacgccc
atgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttcctg
ctcaggaggaagttcatacctgacccccaaggcacgaacctcatgtttgccttctttgca
caacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcaccaag
gccttgggccatggggtagacctcggtcacatttatggagacaatctggagcgtcagtat
caactgcggctctttaaggatgggaaactcaagtaccaggtgctggacggagaagtgtac
cccccctcggtagaagaggcgcctgtgttgatgcactacccccgaggcatcccgccccag
agccagatggccgtgggccaggaggtgtttgggctgcttcccgggctcatgctgtatgcc
acgctctggctacgtgagcacaatcgtgtgtgtgacctgctgaaggctgagcaccccacc
tggggtgatgagcagcttttccagacgacccgcctcatccttataggggagacaatcagg
attgtcatcgaggagtatgtgcagcagctgagtggctacttcctgcagctaaagtttgac
ccagagctgctgtttggtgtccagttccagtaccgcaaccgcattgccatggagttcaac
catctctaccactggcaccccctcatgcctgactccttcaaggtgggctcccaggagtac
agctacgagcagttcttgttcaacacctccatgttggtggactatggggtcgaggccctg
gtggatgccttctctcgccagagcgctggccggatcggtgggggcaggaacatggaccac
cacgtcctgcacgtggctgtggatgtcatcacggagtctcgggagatgcggctgcaaccc
ttcaatgagtaccgcaagaggtttggcatgaagccctacacctccttccaggagctcgta
ggagagaaggagatggcagcggagttggaggagctgtatggcgacattgatgcgttagag
ttctaccctgggctgcttcttgaaaagtgccatccaaactctatctttggggagagtatg
atagagattggggctcccttttccctcaagggtctcctagggaatcccatctgttctccg
gagtactggaagccgagcacatttggcggcgagatgggctttaacatcgtcaagacggcc
acactgaagaagctggtctgcctcaacaccaagacctgtccctacgtttccttccgtgtg
ccggatgccagtcaggatgatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system