KEGG   Chlorocebus sabaeus (green monkey): 103219612Help
Entry
103219612         CDS       T04361                                 

Gene name
GCNT1
Definition
(RefSeq) glucosaminyl (N-acetyl) transferase 1, core 2
  KO
K00727  beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase [EC:2.4.1.102]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00512  Mucin type O-glycan biosynthesis
csab01100  Metabolic pathways
Module
csab_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103219612 (GCNT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csab01003]
    103219612 (GCNT1)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.102  beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
     103219612 (GCNT1)
Glycosyltransferases [BR:csab01003]
 Glycan extension
  O-Glycan
   103219612 (GCNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Branch
Motif
Other DBs
NCBI-GeneID: 103219612
NCBI-ProteinID: XP_007967728
Ensembl: ENSCSAG00000018501
UniProt: A0A0D9SB01
LinkDB All DBs
Position
12
AA seq 428 aa AA seqDB search
MLRKLLRRRLFSYPTKYYFVVLVFSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCT
KVLQGDVNEIQKVKLEILTVKFKKRPRWTHDDYINMTSDCTSFIKRRKYIVEPLSKEEAE
FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVAS
RLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN
SLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVL
QNEKIQKFMEWAQDTYSPDEYLWATIQRIPEVPGSLSASHKYDLSDMQAVARFVKWQYFE
GDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRH
KALETLKH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggaagttgctgcgaaggagacttttttcttatcccactaaatactactttgtg
gttcttgttttttccctaatcaccttctccgttttaaggattcatcaaaagcccgaattt
gtaagtgtcagacacttggagcttgctggggagaatcctagtagtgatattaattgcacc
aaagttttacagggtgatgtaaatgaaatccaaaaggtaaagcttgagatcctaacagtg
aaatttaaaaagcgccctcggtggacacatgatgactatataaacatgaccagtgactgt
acttctttcatcaagagacgcaaatatattgtagaaccacttagtaaagaagaggcagag
tttccaatagcatattctatagtggttcatcacaagattgaaatgcttgacaggctgctg
agggccatctatatgcctcagaatttctattgcattcatgtggacacaaaatccgaggat
tcctatttagctgcagtgatgggcatcgcttcctgtttcagtaatgtctttgtggccagc
cgattggagagtgtggtttatgcatcatggagtcgggttcaggctgacctcaactgcatg
aaggacctctatgcaatgagtgcaaactggaagtacttgataaatctttgtggtatggat
tttcctattaaaaccaacctagaaattgtcaggaagctcaagttgttaatgggagaaaac
agcctggaaacggagaggatgccatcccataaagaagaaaggtggaaaaagcggtatgag
gtcgttaatggaaagctgacaaacacagggactgtcaaaatgcttcctccgctcgaaaca
cctcttttttctggcagtgcctactttgtggtcagtagggagtatgtggggtatgtacta
cagaacgaaaaaatccaaaagtttatggagtgggcacaagacacatacagccctgatgag
tatctctgggccaccatccagaggattcctgaagtcccgggctcactttctgccagccat
aagtacgatttgtctgacatgcaagcagttgccaggtttgtcaagtggcaatactttgag
ggtgatgtttccaagggtgccccctaccctccctgcgatggagtccacgtgcgctcggtg
tgcatttttggagctggtgacttgaactggatgctgcgcaaacaccacttgtttgccaat
aagtttgatgtggatgttgacctctttgccatccagtgtttggatgagcatttgaggcat
aaagctttggagacattaaaacactga

DBGET integrated database retrieval system