KEGG   Chlorocebus sabaeus (green monkey): 103220091
Entry
103220091         CDS       T04361                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01521  EGFR tyrosine kinase inhibitor resistance
csab04010  MAPK signaling pathway
csab04012  ErbB signaling pathway
csab04014  Ras signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04915  Estrogen signaling pathway
csab05200  Pathways in cancer
csab05210  Colorectal cancer
csab05211  Renal cell carcinoma
csab05212  Pancreatic cancer
csab05214  Glioma
csab05215  Prostate cancer
csab05223  Non-small cell lung cancer
csab05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103220091 (TGFA)
   04012 ErbB signaling pathway
    103220091 (TGFA)
   04014 Ras signaling pathway
    103220091 (TGFA)
   04151 PI3K-Akt signaling pathway
    103220091 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103220091 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103220091 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103220091 (TGFA)
   05212 Pancreatic cancer
    103220091 (TGFA)
   05225 Hepatocellular carcinoma
    103220091 (TGFA)
   05214 Glioma
    103220091 (TGFA)
   05211 Renal cell carcinoma
    103220091 (TGFA)
   05215 Prostate cancer
    103220091 (TGFA)
   05223 Non-small cell lung cancer
    103220091 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103220091 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 103220091
NCBI-ProteinID: XP_007968506
Ensembl: ENSCSAG00000015158
LinkDB
Position
14
AA seq 160 aa
MVPSAGQLALFALGIVLAACQALENSTSLLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRSACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtattgtgttggccgcatgc
caggccttggagaacagcacgtccctgctgagcgcagacccgcctgtggctgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcctggctgtggtggccgccagtcagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcgccctcctgaagggaagaagcgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system