KEGG   Chlorocebus sabaeus (green monkey): 103221583
Entry
103221583         CDS       T04361                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01522  Endocrine resistance
csab01524  Platinum drug resistance
csab04012  ErbB signaling pathway
csab04066  HIF-1 signaling pathway
csab04068  FoxO signaling pathway
csab04110  Cell cycle
csab04115  p53 signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04218  Cellular senescence
csab04630  JAK-STAT signaling pathway
csab04921  Oxytocin signaling pathway
csab04928  Parathyroid hormone synthesis, secretion and action
csab04934  Cushing syndrome
csab05160  Hepatitis C
csab05161  Hepatitis B
csab05163  Human cytomegalovirus infection
csab05165  Human papillomavirus infection
csab05166  Human T-cell leukemia virus 1 infection
csab05167  Kaposi sarcoma-associated herpesvirus infection
csab05169  Epstein-Barr virus infection
csab05200  Pathways in cancer
csab05202  Transcriptional misregulation in cancer
csab05203  Viral carcinogenesis
csab05205  Proteoglycans in cancer
csab05206  MicroRNAs in cancer
csab05210  Colorectal cancer
csab05211  Renal cell carcinoma
csab05212  Pancreatic cancer
csab05213  Endometrial cancer
csab05214  Glioma
csab05215  Prostate cancer
csab05216  Thyroid cancer
csab05217  Basal cell carcinoma
csab05218  Melanoma
csab05219  Bladder cancer
csab05220  Chronic myeloid leukemia
csab05222  Small cell lung cancer
csab05223  Non-small cell lung cancer
csab05224  Breast cancer
csab05225  Hepatocellular carcinoma
csab05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103221583 (CDKN1A)
   04630 JAK-STAT signaling pathway
    103221583 (CDKN1A)
   04066 HIF-1 signaling pathway
    103221583 (CDKN1A)
   04068 FoxO signaling pathway
    103221583 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    103221583 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103221583 (CDKN1A)
   04115 p53 signaling pathway
    103221583 (CDKN1A)
   04218 Cellular senescence
    103221583 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103221583 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    103221583 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103221583 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    103221583 (CDKN1A)
   05206 MicroRNAs in cancer
    103221583 (CDKN1A)
   05205 Proteoglycans in cancer
    103221583 (CDKN1A)
   05203 Viral carcinogenesis
    103221583 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103221583 (CDKN1A)
   05212 Pancreatic cancer
    103221583 (CDKN1A)
   05225 Hepatocellular carcinoma
    103221583 (CDKN1A)
   05226 Gastric cancer
    103221583 (CDKN1A)
   05214 Glioma
    103221583 (CDKN1A)
   05216 Thyroid cancer
    103221583 (CDKN1A)
   05220 Chronic myeloid leukemia
    103221583 (CDKN1A)
   05217 Basal cell carcinoma
    103221583 (CDKN1A)
   05218 Melanoma
    103221583 (CDKN1A)
   05211 Renal cell carcinoma
    103221583 (CDKN1A)
   05219 Bladder cancer
    103221583 (CDKN1A)
   05215 Prostate cancer
    103221583 (CDKN1A)
   05213 Endometrial cancer
    103221583 (CDKN1A)
   05224 Breast cancer
    103221583 (CDKN1A)
   05222 Small cell lung cancer
    103221583 (CDKN1A)
   05223 Non-small cell lung cancer
    103221583 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103221583 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103221583 (CDKN1A)
   05161 Hepatitis B
    103221583 (CDKN1A)
   05160 Hepatitis C
    103221583 (CDKN1A)
   05163 Human cytomegalovirus infection
    103221583 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103221583 (CDKN1A)
   05169 Epstein-Barr virus infection
    103221583 (CDKN1A)
   05165 Human papillomavirus infection
    103221583 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103221583 (CDKN1A)
   01522 Endocrine resistance
    103221583 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103221583
NCBI-ProteinID: XP_007970970
Ensembl: ENSCSAG00000010296
UniProt: A0A0D9RD37
LinkDB
Position
17
AA seq 164 aa
MSEQAGSVRPNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQPEESPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaacaggctggcagtgtccgtccgaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgtatccaggaggctcgtgaacgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccaca
gggccccggcggggccgggatgagttgggaggaggcaggcggcctggcacctcgcccgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcgctatcttgtacccttgtg
cctcgctcaggggagcagcctgaagagtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system