KEGG   Chlorocebus sabaeus (green monkey): 103221945Help
Entry
103221945         CDS       T04361                                 

Gene name
HIST1H3J
Definition
(RefSeq) histone H3.1-like
  KO
K11253  histone H3
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab05034  Alcoholism
csab05202  Transcriptional misregulation in cancer
csab05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:csab00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    103221945 (HIST1H3J)
  Immune diseases
   05322 Systemic lupus erythematosus
    103221945 (HIST1H3J)
  Substance dependence
   05034 Alcoholism
    103221945 (HIST1H3J)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    103221945 (HIST1H3J)
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103221945 (HIST1H3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF TFIID-31kDa PAF
Motif
Other DBs
NCBI-GeneID: 103221945
NCBI-ProteinID: XP_007971598
LinkDB All DBs
Position
17
AA seq 181 aa AA seqDB search
MKMVLRTNQVIPTAVLTNQDQIIVINSGRSHCSFSALFQSIAFSIMARTKQTARKSTGGK
APRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREI
AQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggtactaagaaccaatcaggttattcccacagcagttctgaccaatcaggat
cagatcatcgttataaattctggtagaagccactgctcattcagtgctttatttcagagc
atagctttctcaattatggctcggacgaagcagacagcccgcaagtccaccggcggcaag
gcaccgcggaagcagctggccaccaaggcagcgcgcaaaagcgctccagcaactggcggt
gtgaagaagccccaccgctaccggcctggcactgtggccttgcgcgagatccgccgttat
cagaagtcgactgagttgctcatccgcaaactgccatttcagcgcctggtgcgagaaatc
gcgcaggatttcaaaactgaccttcgtttccagagctcggcggtgatggcgctgcaagag
gcgtgcgaagcctatctggtggggctctttgaggacaccaatctctgtgctattcacgcc
aagcgcgtcactattatgcctaaggacatccagcttgcgcgtcgtattcgtggtgagcga
gcataa

DBGET integrated database retrieval system