KEGG   Chlorocebus sabaeus (green monkey): 103222237Help
Entry
103222237         CDS       T04361                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:csab00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    103222237 (F13A1)
Enzymes [BR:csab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103222237 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103222237
NCBI-ProteinID: XP_007971981
Ensembl: ENSCSAG00000007361
LinkDB All DBs
Position
17
AA seq 756 aa AA seqDB search
MSETSRIAFGGRRAVPPNNSNAAEDELPTLEPQGVVPRGVNLQGMSIHPLPTTLGPGTAG
PWPLFPAEFLNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYIQIDFNRPYDPR
RDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSVQSSPECIVG
KFRMYVAVWTPYGIIRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYG
EVNDIKTRSWSYGQFEDGILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVL
VGSWDNIYAYGVPPSAWTGSVDILLEYQSSENPVRYGQCWVFAGVFNTFLRCLGIPARIV
TNYFSAHDNDANLQMDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAV
DSTPQENSDGMYRCGPASVQAIKHGHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENV
DATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSR
SKVDMDFEVENAVLGKDLKLTITFRNNSHNHYTITAYLSANITFYTGVSKAEFKKETFDV
TLEPLSFKKEAVLIQAGEYMGQLLEQASLHFFVTARINETRDVLAKQKSTVLTIPKLIIK
VRGAQVVGSDMIVTVEFTNPLKETLRNVWIHLDGPGITRPMRKMFREIRPNSTVQWEEVC
RPWVSGPRKLIASMSSDSLRHVYGELDMQIQRRPSM
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacctccagaatcgcctttggaggcaggagagcggttccaccgaataactct
aatgcagcggaagatgagctgcccacactggagcctcagggcgtggtgccccggggcgtc
aacctgcaaggtatgagcatacaccccctccccaccactctgggtccaggcacagctggg
ccctggcccctcttccctgcagagtttcttaatgtcacgagcgttcacctgttcaaggag
agatgggacactaacaaggtggaccaccacactgacaagtatgaaaacaacaagctgatt
gtccgcagagggcagtctttctacattcagattgacttcaatcgtccatatgaccccaga
cgggatctcttcagggtggaatacgtcattggtcgctacccacaggagaacaagggaacc
tacatcccagtgcctatagtctcagagttacaaagtggaaagtggggggccaagattgtc
atgagagaggacaggtctgtgcggctgtccgtccagtcttcccccgaatgtattgtgggg
aaattccgcatgtatgttgctgtctggaccccctatggcataattcgaaccagtcgaaac
ccagaaacagacacgtacattctcttcaatccttggtgtgaagatgatgctgtgtacctg
gacaatgagaaagaaagagaagagtatgtcctgaatgacattggagtaattttttatgga
gaggtcaatgacatcaagaccagaagctggagctatggtcagtttgaagatggtatcctg
gacacttgcctgtatgtgatggacagagcacaaatggacctctctggaagagggaatccc
atcaaagtcagccgtgtggggtctgcaatggtgaatgccaaagatgacgaaggtgtcctc
gttggatcctgggacaatatctatgcctatggtgtccccccatcggcctggactggaagc
gttgacattctattggaataccagagctctgagaatccagtccgatatggccaatgctgg
gtttttgctggtgtctttaacacatttttacgatgccttggaataccagcaagaattgtt
accaattatttctctgcccatgataatgatgccaatttgcaaatggacatcttcctggaa
gaagatgggaacgtgaattccaaactcaccaaggattcagtgtggaactaccactgctgg
aatgaagcatggatgacaaggcctgaccttcctgttggatttggaggctggcaagctgtg
gacagcaccccccaggaaaacagcgatggcatgtatcggtgtggccccgcctccgttcaa
gccatcaagcacggccacgtctgcttccaatttgatgcaccttttgtttttgcagaggtc
aacagcgacctcatttacattacagctaagaaagatggcactcatgtggtggaaaatgtg
gatgccacccacattgggaaattaattgtgaccaaacaaattggaggagatggcatgatg
gatattactgatacttacaaattccaagaaggtcaagaagaagagagactggccctagaa
actgccctgatgtacggagctaaaaagcccctcaacacagagggtgtcatgaaatcgagg
tccaaagttgacatggactttgaagtggaaaatgccgtgctgggaaaagacctcaagctc
accatcaccttccggaacaacagccacaaccattacaccatcacagcttatctctcagcc
aacatcaccttctacaccggggtctcgaaggcagaattcaagaaggagacattcgacgtg
acgctggagcccttgtccttcaagaaagaggcggtactgatccaagccggcgagtacatg
ggtcagctgctggaacaagcgtccctgcacttctttgtcacagctcgcatcaatgagacc
agggatgttctggctaagcagaagtccaccgtgctgaccatccctaagctcatcatcaag
gtccgtggcgctcaggtagttggttccgacatgattgtgacagttgaatttaccaatcct
ttaaaagaaacgctgcgaaatgtctggatacacctggatggtcctggaataacaagaccg
atgaggaagatgttccgtgaaatccggcccaactccaccgtacaatgggaagaagtgtgc
cggccctgggtctctgggcctcggaagctgatagccagcatgagcagtgactccctgaga
catgtgtatggcgagctggacatgcagattcaaagacgaccttccatgtga

DBGET integrated database retrieval system