KEGG   Chlorocebus sabaeus (green monkey): 103223764
Entry
103223764         CDS       T04361                                 

Gene name
AIM2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04621  NOD-like receptor signaling pathway
csab04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:csab00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103223764 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    103223764 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 103223764
NCBI-ProteinID: XP_007974775
Ensembl: ENSCSAG00000002445
UniProt: A0A0D9S408
LinkDB
Position
20
AA seq 343 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVANLMIQNAGAVS
AVKKTILIFQKLNYMLLAKRLQEEKEKVDKKYKSVTKPKPLSQAEMSPAASAAIRNDVTK
QRAAPKVSPHVKPEQKQRVAQQESITEEFRKDCLPVMVLKATKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRMIIISRYYQHSGFLEVNSASCVLDAKSDQTVDVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNVLFDLSDKTGEMEVLAVRNED
TMQCKEGDKVRLTFFTLSKNGEKPRLTSGVHSIIKVIKASKKT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacgggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatatcgccacaggcaaacta
catactgcaaacagaatacaagtagctaacttgatgattcaaaatgctggtgcagtgtct
gcagtgaagaagacgattcttatttttcagaagttgaattatatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgataagaaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcacaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgagcagaaacagagggtggcc
cagcaggaatctatcacagaagagtttcggaaagactgtttgccagttatggtactgaaa
gcaacaaagcccttcacgtttgagacccaagaaggcaagcaagagatgtttcatgctaca
gtggctacagagaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaatgattataatatcaagatattatcagcacagtggtttcttagag
gtaaatagcgcctcatgtgtgttagatgctaaatctgaccaaacggttgatgtcccgctg
aacattatcagaaaagctggtgaaaccccaaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatgggttgtttgtagtccagaaggtaacagaaaagaagaaaaatgta
ttatttgacctaagtgacaagactggggaaatggaagtattggcggttagaaacgaggac
acaatgcaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaaccacggctgacatcgggagttcatagcatcataaaggttattaaggccagt
aaaaaaacatag

DBGET integrated database retrieval system