KEGG   Chlorocebus sabaeus (green monkey): 103225507Help
Entry
103225507         CDS       T04361                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00020  Citrate cycle (TCA cycle)
csab00190  Oxidative phosphorylation
csab01100  Metabolic pathways
csab01200  Carbon metabolism
csab04714  Thermogenesis
csab04932  Non-alcoholic fatty liver disease (NAFLD)
csab05010  Alzheimer disease
csab05012  Parkinson disease
csab05016  Huntington disease
Module
csab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csab_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103225507 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103225507 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103225507 (SDHB)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    103225507 (SDHB)
   05012 Parkinson disease
    103225507 (SDHB)
   05016 Huntington disease
    103225507 (SDHB)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103225507 (SDHB)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103225507 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 103225507
NCBI-ProteinID: XP_007978514
Ensembl: ENSCSAG00000000860
UniProt: A0A0D9S8F8
LinkDB All DBs
Position
20
AA seq 280 aa AA seqDB search
MAAVVALSLRGRLPATTLGGACLQASRGAQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcactctccttgaggggccggttaccggccacaacccttggcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagccgcagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tacgaaattgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaaattgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccacatatgtatgtgataaaggaccttgtt
cccgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcagaaatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system