KEGG   Chlorocebus sabaeus (green monkey): 103226145Help
Entry
103226145         CDS       T04361                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00010  Glycolysis / Gluconeogenesis
csab00052  Galactose metabolism
csab00500  Starch and sucrose metabolism
csab00520  Amino sugar and nucleotide sugar metabolism
csab00524  Neomycin, kanamycin and gentamicin biosynthesis
csab01100  Metabolic pathways
csab01200  Carbon metabolism
csab04910  Insulin signaling pathway
csab04911  Insulin secretion
csab04917  Prolactin signaling pathway
csab04922  Glucagon signaling pathway
csab04930  Type II diabetes mellitus
csab04950  Maturity onset diabetes of the young
csab05230  Central carbon metabolism in cancer
Module
csab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csab_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103226145 (GCK)
   00052 Galactose metabolism
    103226145 (GCK)
   00500 Starch and sucrose metabolism
    103226145 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    103226145 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103226145 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103226145 (GCK)
   04910 Insulin signaling pathway
    103226145 (GCK)
   04922 Glucagon signaling pathway
    103226145 (GCK)
   04917 Prolactin signaling pathway
    103226145 (GCK)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    103226145 (GCK)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103226145 (GCK)
   04950 Maturity onset diabetes of the young
    103226145 (GCK)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     103226145 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103226145
NCBI-ProteinID: XP_007979654
Ensembl: ENSCSAG00000015587
UniProt: A0A0D9RST3
LinkDB All DBs
Position
21
AA seq 466 aa AA seqDB search
MAMDATRSQAQTALTLVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLP
TYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTA
EMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGN
NVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQ
NVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMG
ELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRP
SATDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSF
KEQFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatgccacaaggagccaggcccagacagccttgactctggtagagcagatc
ctggcggagttccagctgcaggaggaggacctgaagaaggtgatgagacggatgcagaag
gagatggaccgtggcctgaggttggagacccatgaagaggccagtgtgaagatgctgccc
acctacgtgcgctccaccccagaaggctcagaagtcggggacttcctctccctggacctg
ggtggcaccaacttcagggtgatgctggtgaaggtgggagaaggtgaggaggggcagtgg
agcgtgaagaccaaacaccagatgtactccatccccgaggacgccatgaccggcactgct
gagatgctcttcgactacatctccgagtgtatctccgacttcctggacaaacatcagatg
aagcacaagaagctgcccctgggcttcaccttctcctttcctgtgaggcatgaagacatc
gataagggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaac
aatgtcgtggggcttctgcgagacgccatcaaacggagaggggacttcgaaatggatgtg
gtggcaatggtgaatgacacggtggccacgatgatctcctgctactacgaagaccatcag
tgcgaggtcggcatgattgtgggcacgggctgcaacgcctgctacatggaggagatgcag
aatgtggagctggtggagggagacgagggccgcatgtgcgtcaacaccgaatggggcgcc
ttcggggactcgggcgagctggacgagttcctgctggagtatgaccgcctggtggacgag
agctctgcaaaccccggtcagcagctgtatgagaagctcataggtggcaagtacatgggc
gagctggtgcggctcgtgctgctcaggctcgtggacgaaaacctgctcttccacggggag
gcctccgagcagctgcgcacacgcggagccttcgagacacgcttcgtgtcgcaggtggag
agcgacacgggcgaccgcaagcagatctacaacatcctgagcacgctggggctacgaccc
tcggccactgactgcgacatcgtgcgccgcgcctgcgagagcgtgtctacgcgcgctgca
cacatgtgctcggcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgag
gatgtaatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcaccccagcttc
aaggagcagttccacgctagcgtgcgcaggctgacgcccagctgcgagatcaccttcatc
gagtcggaggagggcagtggccggggcgcggccctggtctcggcggtggcctgtaagaag
gcctgcatgctgggccagtga

DBGET integrated database retrieval system