KEGG   Chlorocebus sabaeus (green monkey): 103227040Help
Entry
103227040         CDS       T04361                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00052  Galactose metabolism
csab00500  Starch and sucrose metabolism
csab01100  Metabolic pathways
csab04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103227040
   00500 Starch and sucrose metabolism
    103227040
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103227040
Enzymes [BR:csab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103227040
    3.2.1.20  alpha-glucosidase
     103227040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 PagP HCV_NS4b
Motif
Other DBs
NCBI-GeneID: 103227040
NCBI-ProteinID: XP_007981386
LinkDB All DBs
Position
21
AA seq 203 aa AA seqDB search
MFIRISTRLASKYLYGFGETEHTSYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLE
EDGNAHGVFLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPV
MVPYWSLGFQLCRYGYENDSEIASLYDDMVAAQIPYVRSQSWLWSLVTNPGASVSGFICL
MLVGFYKDIMFFFRQYYSLTRAQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttattcgcatctccacccgccttgcctccaagtacctctatggctttggggaaact
gagcacacatcctacaggagagacttggagtggcacacttgggggatgttctcccgagac
cagcccccagggtacaagaagaattcctatggtgtccacccctactacatggggctggag
gaggacggcaatgcccatggagtgttcctgctgaacagcaatgccatggacgtgacattc
cagcccctgcctgccttgacataccgtaccacagggggagttctggacttttatgtgttc
ttggggccaactccagagcttgtcacccagcagtacactgagttgattggccggcctgtg
atggtaccttactggtctttgggtttccagctgtgtcgctatggatacgagaatgactct
gagatcgccagcttgtatgatgacatggtggccgcccagatcccttatgtacgttctcag
tcatggctctggagtttggtaactaacccaggtgcctctgtgtctgggttcatttgtcta
atgttggtgggattctataaagacataatgttctttttcagacaatattacagcctcacc
cgagcacagtaa

DBGET integrated database retrieval system