KEGG   Chlorocebus sabaeus (green monkey): 103227042Help
Entry
103227042         CDS       T04361                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00052  Galactose metabolism
csab00500  Starch and sucrose metabolism
csab01100  Metabolic pathways
csab04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103227042 (MGAM)
   00500 Starch and sucrose metabolism
    103227042 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103227042 (MGAM)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103227042 (MGAM)
    3.2.1.20  alpha-glucosidase
     103227042 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103227042
NCBI-ProteinID: XP_007981387
Ensembl: ENSCSAG00000008027
LinkDB All DBs
Position
21
AA seq 1897 aa AA seqDB search
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTITST
QPGTTGPPDPGTTTSTHPRTTGPPDPGTTGSTHPRTTGPLDPGTTGSTHPRTTGPLDPGT
TGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHM
EGDLVNTNAGFTARLKNLPSSPMFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHE
HVQSFSGYAASSLTYRVEISREPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPS
ANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVF
LMNSNAMEVVLQPAPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGF
HLSRYEYGTLDNMREVLERNRAAQLPYDVQHADIDYMDERRDFTYDPVNFKGFPEFVNDL
HKNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPD
YTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRVLD
GYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKTVFPNNRSFILTRSTFAGSGK
FAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGFALDASEELCRRWMQLGAFY
PFSRNHNGQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARP
LLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGNQVRWRKQ
KVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGE
TKDTVANKVYLLCEFSVTRNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGV
PTQTSPTVTYDSNLKVAIVTDIDLLLGEAYTVEWDIKIRDDEKIDCYPDENGASAENCAA
RGCIWEASNSSGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSVYANAFPSTPVNPLRL
DVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPMVPSSTPEGQLYDVLIKKNPFGIEIRRKS
TGTIIWDSQLLGFTFNDMFIRISTRLASKYLYGFGETEHTSYRRDLEWHTWGMFSRDQPP
GYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGP
TPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDDMVAAQIPYDVQYSDI
DYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGLEDDIF
IKYPNDGDIVWGKVWPDFPGVVVNESLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEE
LYNNPQNPERSLKFDGLWIDMNEPSSFVNGAVSPGCREASLNRPPYMPYLESRDRGLSSK
TLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVTGQRGVVISRSTFPSSGRWA
GHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPF
SRNHNTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMYKAHTEGVTVVRPLLHE
FVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTGVDVNARGEWKTL
PAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAEGWLFWDDGQSIDT
YGKGLYYLANFSASQNTMQSHIIFNNYITDTNPLKLGYIEIWGVGSVPITSVSISVSDMA
ITPSFNNDPTTQVLSIDVTDRNISVHNFTSLTWRSTP
NT seq 5694 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
ctcgtgttgtttatcatcagtattgttctaattgtgcttttagccaaggagtcattgaaa
tcaacagccccagatcccgggacaactggtaccccagatcctggaacaatcacttccacg
cagcctgggacaactggtcccccagatcctggaacaaccacttccacgcatcctaggaca
actggtcccccagatcctggaacaactggttccacgcatcctaggacaacgggtccccta
gatcctggaacaactggttccacgcatcctaggacaacgggtcccctagatcctggaaca
actggtaccactcctgtttctgctgaatgtccagtggtaaatgaattggaacgaattaat
tgcatccctgaccagccaccaacaaaggccacatgtgaccaacgtggctgttgctggaat
ccccagggagctgtaagtgttccctggtgctactattccaagaatcatagctaccacatg
gagggcgaccttgtaaacacaaatgcaggattcacagcccggttgaaaaatctgccttct
tcacccatgttcggaagcaatgttgacaacgttcttctcacagcagagtatcagacatct
aatcgtttccactttaagttgaccgaccaaaccaataacaggtttgaagtaccccacgaa
catgttcagtccttcagtggatatgctgcttcttctttgacctaccgagttgaaatctcc
agagagccatttagcatcaaagtgaccagaagaagcaacaatcgtgttttgtttgactca
agcattgggcccctcctgtttgccgaccagttcttgcagctctccacccgactgcctagt
gctaacgtgtatggcctgggagagcatgtgcaccagcagtaccggcatgatatgaattgg
aagacttggcccatatttaacagggacacaactcccaatggaaacggaactaatttgtat
ggtgcgcagacattcttcctgtgtctcgaagatgctagtggattgtcctttggggtgttt
ctgatgaacagcaatgccatggaggttgtccttcagcccgcgccagccatcacttaccgc
accactgggggcattctcgacttctatgtgttcttgggaaacactccagagcaagttgtt
caagaatatctagagcttattgggcggccagcccttccctcctactgggcacttggattt
cacctcagtcgttatgaatatggaaccttagacaacatgagagaagtcttggagagaaat
cgcgcagcacagctcccttatgatgttcagcatgctgatattgattatatggatgagaga
agggacttcacttatgatccagtgaattttaaaggcttccctgaatttgtcaatgactta
cacaaaaatggacagaagcttgtcatcattgtggatccagccatctccaacaactcttcc
tcaagtaaaccctatggcccatatgacaggggttcagatatgaagatatgggtgaatagt
tcagatggcgtgactccactcatcggggaggtctggcctggacaaactgtgtttcctgat
tataccaatcccaactgtgctgtttggtggacaaaggaatttgaactttttcataatcaa
gtggagtttgatggaatctggattgatatgaatgaagtctccaactttgttgatggttcg
gtctcaggatgttccacaaacaacctaaataatcccccattcactcccagagtcctggat
gggtacctgttctgcaagactctctgtatggatgcagtgcagcactggggcaagcagtat
gacgttcacaatctgtacggctactccatggcggttgccacagcagaagctgccaagact
gtgttccctaataacagaagcttcattctgacccgttctacctttgcgggttctggcaag
tttgcagcacattggttaggagacaacaccgccacctgggatgacctgcgatggtccatc
cctggcgtgcttgagttcaaccttttcggcatcccaatggtgggtgctgacatatgtggc
tttgccttggatgcctctgaggagctctgtagacggtggatgcagttgggcgcattttat
ccattttctagaaatcacaatggccaaggcttcaaggaccaggatcctgcctcctttgga
gctgactccctgctgttgaattcctccaggcactaccttaacatccgctatactctattg
ccctacctatacaccctcttcttccgtgctcacagccgaggggacacggtggccaggccc
cttttgcatgagttctacgaggacaacagcacttgggatgtgcaccaacagttcttatgg
gggcccggcctcctcatcactccagttctggatgaaggtgcagagaaagtgatggcatat
gtgcctgatgctgtctggtatgactacgagactgggaaccaagtgagatggaggaagcaa
aaagtcgagatggaacttcctggagacaaaattggacttcaccttcgaggaggctacatc
tttcccacacagcagccaaatacaaccactctggccagtcgaaagaaccctcttggtctt
atcattgccctagatgagaacaaagaagcaaaaggagaacttttctgggatgatggggaa
acgaaggatactgtggccaataaagtgtatcttttatgtgagttttctgtcactcgaaac
cgcttggaggtgaatatttcacagtcaacctacaaggaccccaataatttagcatttaat
gaaattaaaattcttgggacggaggaacctagcaatgttacagtgaaacacaatggtgtc
ccaactcagacttctccgacagtcacttatgattctaacctgaaggttgccattgtcaca
gatattgatcttctcctgggagaagcatacacagtggagtgggatataaagataagggat
gatgaaaaaatagactgttaccctgatgagaatggcgcttctgcagaaaactgtgctgcc
cgtggctgtatctgggaggcatccaattcttctggagtccctttttgctattttgtcaac
gatctatactctgtcagtaatgttcaatataattcacatggggccacagctgacatctcc
ttaaagtcttccgtgtatgccaatgccttcccctccacacccgtgaacccccttcgcctg
gatgtcacttaccataagaatgaaatgctgcagttcaagatttatgatcccaacaacaat
cggtatgaagttccagttcctctgaacatacccatggtgccatccagcacccctgagggt
caactctatgatgtcctcattaagaagaatccatttgggattgaaattcgccgcaagagt
acaggaactataatttgggactctcagctccttggcttcaccttcaatgacatgtttatc
cgcatctccacccgccttgcctccaagtacctctatggctttggggaaactgagcacacg
tcctataggagagacttggagtggcacacttgggggatgttctcccgagaccagccccca
gggtacaagaagaattcctacggtgtccacccctactacatggggctggaggaggacggc
agtgcccacggagtgttcctgctgaacagcaatgccatggacgtgacgttccagcccctg
cctgccttgacataccgtaccacagggggagttctggacttttatgtgttcttggggcca
actccagagcttgtcacccagcagtacacggagttgattggccggcctgtgatggtacct
tactggtctttgggtttccagctgtgtcgctatggataccagaacgactctgagatcgcc
agcttgtatgatgacatggtggccgcccagatcccttatgacgtgcagtactcagacatc
gactacatggagcggcagctggacttcaccctcagccccaagtttgctgggtttccagct
ctgatcaatcgcatgaaagctgatgggatgcgggtcatcctcattctggatccagccatt
tctggcaatgagacccagccctatcctgccttcactcggggcttggaggatgacatcttc
atcaaatacccaaatgatggagacattgtctggggaaaggtctggcccgattttcctggt
gttgttgtgaatgaatctctagactgggacagccaagtggagctatatcgagcttacgtg
gccttcccagactttttccgtaattcaactgccaagtggtggaagagggaaatagaagaa
ctgtacaacaatccacagaatccagagaggagcttgaagtttgatggcctgtggattgat
atgaatgaaccatcaagcttcgtgaatggggcagtttctccaggctgcagggaggcctct
ctgaaccgccctccctacatgccgtatttggagtccagggacaggggcctgagcagcaag
accctgtgcatggagagtcagcagatcctcccagacggctccccggtgcagcactacaac
gtgcacaacctgtacgggtggtcccagaccagacccacatatgaagccatgcaggaggtg
acgggacagcgaggggtcgtcatcagccgctccacatttccctcttctggccgctgggca
ggacattggctgggagacaacacggccgcgtgggatcagctgaagaaatctatcattggc
atgatggagttcagcctcttcggcatatcctatacaggagcagatatctgtgggtttttt
caagatgctgaatatgagatgtgtgttcgctggatgcagctgggggccttttaccccttc
tcaagaaaccacaacaccattgggaccaggagacaagaccctgtgtcctgggatgctgct
tttgtgaacatttccagaaatgtcctgcagaccagatacaccctgttgccatatctgtat
accttgatgtataaggcccacacggagggcgtcactgttgtgcggcctctgcttcatgag
tttgtgtcagaccaggtgacgtgggacatagacagtcagttcctgctgggcccagccttc
ctggtcagccctgtcctggagcgcaatgccagaaatgtcactgcatatttccctagagcc
cgctggtacgattactacacgggtgtggatgtgaacgcaagaggagagtggaagaccttg
ccggcccctcttgaccacattaatcttcatgtccgtgggggctacatcctgccctggcaa
gagcctgcactgaacacccacttaagccgccagaagttcatgggcttcaaaattgccttg
gatgatgagggaactgctgagggctggctcttctgggatgatgggcaaagcattgatacc
tatgggaaaggactctattacttggccaacttttctgccagccagaatacgatgcaaagc
catataattttcaacaattacatcactgatacaaatcctttgaaactgggctacattgaa
atctggggagtgggcagtgtccccatcaccagtgtcagcatatctgtgagcgacatggcc
ataacaccctccttcaacaatgaccccacgacacaggtattaagcatcgatgtgactgac
agaaacatcagtgtacataattttacttcattgacatggagaagcactccgtga

DBGET integrated database retrieval system