KEGG   Chlorocebus sabaeus (green monkey): 103227364
Entry
103227364         CDS       T04361                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01523  Antifolate resistance
csab04010  MAPK signaling pathway
csab04014  Ras signaling pathway
csab04024  cAMP signaling pathway
csab04062  Chemokine signaling pathway
csab04064  NF-kappa B signaling pathway
csab04066  HIF-1 signaling pathway
csab04071  Sphingolipid signaling pathway
csab04137  Mitophagy - animal
csab04151  PI3K-Akt signaling pathway
csab04210  Apoptosis
csab04211  Longevity regulating pathway
csab04218  Cellular senescence
csab04380  Osteoclast differentiation
csab04620  Toll-like receptor signaling pathway
csab04621  NOD-like receptor signaling pathway
csab04622  RIG-I-like receptor signaling pathway
csab04623  Cytosolic DNA-sensing pathway
csab04625  C-type lectin receptor signaling pathway
csab04657  IL-17 signaling pathway
csab04658  Th1 and Th2 cell differentiation
csab04659  Th17 cell differentiation
csab04660  T cell receptor signaling pathway
csab04662  B cell receptor signaling pathway
csab04668  TNF signaling pathway
csab04722  Neurotrophin signaling pathway
csab04917  Prolactin signaling pathway
csab04920  Adipocytokine signaling pathway
csab04926  Relaxin signaling pathway
csab04931  Insulin resistance
csab04932  Non-alcoholic fatty liver disease
csab04933  AGE-RAGE signaling pathway in diabetic complications
csab05010  Alzheimer disease
csab05022  Pathways of neurodegeneration - multiple diseases
csab05030  Cocaine addiction
csab05132  Salmonella infection
csab05133  Pertussis
csab05134  Legionellosis
csab05135  Yersinia infection
csab05140  Leishmaniasis
csab05142  Chagas disease
csab05145  Toxoplasmosis
csab05146  Amoebiasis
csab05152  Tuberculosis
csab05160  Hepatitis C
csab05161  Hepatitis B
csab05162  Measles
csab05163  Human cytomegalovirus infection
csab05164  Influenza A
csab05165  Human papillomavirus infection
csab05166  Human T-cell leukemia virus 1 infection
csab05167  Kaposi sarcoma-associated herpesvirus infection
csab05168  Herpes simplex virus 1 infection
csab05169  Epstein-Barr virus infection
csab05170  Human immunodeficiency virus 1 infection
csab05200  Pathways in cancer
csab05202  Transcriptional misregulation in cancer
csab05203  Viral carcinogenesis
csab05212  Pancreatic cancer
csab05215  Prostate cancer
csab05220  Chronic myeloid leukemia
csab05221  Acute myeloid leukemia
csab05222  Small cell lung cancer
csab05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
csab05321  Inflammatory bowel disease
csab05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103227364 (RELA)
   04014 Ras signaling pathway
    103227364 (RELA)
   04064 NF-kappa B signaling pathway
    103227364 (RELA)
   04668 TNF signaling pathway
    103227364 (RELA)
   04066 HIF-1 signaling pathway
    103227364 (RELA)
   04071 Sphingolipid signaling pathway
    103227364 (RELA)
   04024 cAMP signaling pathway
    103227364 (RELA)
   04151 PI3K-Akt signaling pathway
    103227364 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103227364 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    103227364 (RELA)
   04218 Cellular senescence
    103227364 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103227364 (RELA)
   04621 NOD-like receptor signaling pathway
    103227364 (RELA)
   04622 RIG-I-like receptor signaling pathway
    103227364 (RELA)
   04623 Cytosolic DNA-sensing pathway
    103227364 (RELA)
   04625 C-type lectin receptor signaling pathway
    103227364 (RELA)
   04660 T cell receptor signaling pathway
    103227364 (RELA)
   04658 Th1 and Th2 cell differentiation
    103227364 (RELA)
   04659 Th17 cell differentiation
    103227364 (RELA)
   04657 IL-17 signaling pathway
    103227364 (RELA)
   04662 B cell receptor signaling pathway
    103227364 (RELA)
   04062 Chemokine signaling pathway
    103227364 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103227364 (RELA)
   04917 Prolactin signaling pathway
    103227364 (RELA)
   04926 Relaxin signaling pathway
    103227364 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103227364 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103227364 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    103227364 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103227364 (RELA)
   05202 Transcriptional misregulation in cancer
    103227364 (RELA)
   05203 Viral carcinogenesis
    103227364 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103227364 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103227364 (RELA)
   05221 Acute myeloid leukemia
    103227364 (RELA)
   05220 Chronic myeloid leukemia
    103227364 (RELA)
   05215 Prostate cancer
    103227364 (RELA)
   05222 Small cell lung cancer
    103227364 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103227364 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103227364 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    103227364 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    103227364 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103227364 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103227364 (RELA)
   04931 Insulin resistance
    103227364 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103227364 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103227364 (RELA)
   05135 Yersinia infection
    103227364 (RELA)
   05133 Pertussis
    103227364 (RELA)
   05134 Legionellosis
    103227364 (RELA)
   05152 Tuberculosis
    103227364 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103227364 (RELA)
   05170 Human immunodeficiency virus 1 infection
    103227364 (RELA)
   05162 Measles
    103227364 (RELA)
   05164 Influenza A
    103227364 (RELA)
   05161 Hepatitis B
    103227364 (RELA)
   05160 Hepatitis C
    103227364 (RELA)
   05168 Herpes simplex virus 1 infection
    103227364 (RELA)
   05163 Human cytomegalovirus infection
    103227364 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103227364 (RELA)
   05169 Epstein-Barr virus infection
    103227364 (RELA)
   05165 Human papillomavirus infection
    103227364 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103227364 (RELA)
   05145 Toxoplasmosis
    103227364 (RELA)
   05140 Leishmaniasis
    103227364 (RELA)
   05142 Chagas disease
    103227364 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103227364 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csab03000]
    103227364 (RELA)
Transcription factors [BR:csab03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    103227364 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 103227364
NCBI-ProteinID: XP_007981896
Ensembl: ENSCSAG00000007981
LinkDB
Position
1
AA seq 551 aa
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAITQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRTSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALASAPPQVLPQAPAPAPAPAMVSALAQAPVPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPTVFTDLASVDNSEFQQLLNQ
GVPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtacgcatctccctagtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcactcagcgcatccagacgaacaacaatccc
ttccaagttcctatagaagaacagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggatccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaaccgtgcccccaacactgccgaactcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcccgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggatcgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccactgacccccggcctccacctcggcgcattgctgtgccttcccgcacctcagcttct
gttcccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttctgggcagataagccaggcctcagccttggcc
tcggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagtccctgtcccagtcctagccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccttg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
accgtgttcacagacctggcatcagtcgacaactccgagtttcagcagctgctgaaccag
ggcgtacctgtggccccccacacaactgagcccatgctcatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccctgacccagctcctgctccactgggggcc
ccggggctccccaacggcctcctttcaggagatgaagacttctcctccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

DBGET integrated database retrieval system