KEGG   Chlorocebus sabaeus (green monkey): 103227561Help
Entry
103227561         CDS       T04361                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103227561 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csab03036]
    103227561 (SETD2)
Enzymes [BR:csab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103227561 (SETD2)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103227561 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 103227561
NCBI-ProteinID: XP_007982230
Ensembl: ENSCSAG00000016130
LinkDB All DBs
Position
22
AA seq 2574 aa AA seqDB search
MKQLQPQPPPKMGDFYDPEHPTPDMFSWLNGNREEENEAKIENVQKTGFIKGPMFKGVAS
SRFLPKGTKTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQSDTPNPPAVPLQVD
STPKMKMEIGDTLSTAEESSPPKSRVELGKIHFKKHLLHVTSRPLLVTTTAVASPPTHAA
PLPAVIAESTTVDSPPSSPPPPPPPAQATTPSSPAPITEPVALPHTPVTVLMAAPVPLPV
DVAVRSLKEPPIIIVPESLEADTKQDTVSNSSEEHITQILNEQADISSKKEDSHIGKDEE
IPDSSKISLSCKKTGSKKKSSQSEGTFLGSESDEDSVRTSSSQRSHDLKFSASIERERDF
KKSSAPLKSEDLGKSSRSKTERDDKYFSYSKLERDTRYVSSRCRSERERRRSRSHSRSER
GPRTNLSYSRSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSEEEYKKTYSR
RTSSHSSSYRDLRTSSYSKSDRDCKTETSYLEMERRGKYSSKLERESKRTSENEAVKRCC
SPPNELGFRRGSSYSKHDSSASRYKSTLSKPIPKSDKFKNSFCCTELNEEIKQSHSFSLQ
TPCSKGSELRMINKNPEREKAGSPAPSNRLNDSPTLKKLDEFPIFKSEFITHDSHDSIKE
LDSLSKVRNDQLRSFCPIELNINGSPGAESDLATFCTSKTDAVLMTSDDSVTGSEVSPLV
KACMLSSNGFQNISRCKGKDLDDTRMLHKKSESPFRETEPLVSPHQDKLMSLQVMTIDYS
KTVVKEPVDTRVSCCKTKDSDIYCTSNDSNNPSLCNSEAENIEPSVMKISSNSFMNVHLE
SKPVICDSRNLTDHSKFACEEYKQSIGSTSSASVNHFDDLYQPIGSSDIASSLQSLPPGI
KVDSLTLLKCGENTSPVLDAVLKSRKSSEFLKHAGKETVVEVGSDLPDSGKGFASRENRR
NNGLSGKCLQEAQEEGNSILPDRRGRPEISLQERGEGGRVHTSDDSEVVFSSCDLNLTME
DSDGVTYALKCDSSGHAPEIVSTVHEDYSDSSESSSDESDSEDTDSDDSSIPRNRLQSVV
VVPKNSTLPVEETSPCSSRSSQSYRHYSDHWEDERLESRRHSYEEKFESIANKACPQTDK
FFLHKGAEKNPEISFTQSNRKQIDNHLPELSHPQSDGVDSTSHTDVKSDSLGHPNSEETV
KAKISSRQQEELPIYSSDFEDVPNKSWQQTTFQNRPDSRLGKTELSFSSSCEISRVDGLH
SSEELRNLGWDFSQEKPSTTYQQPDSSYGTCGGHKYQQNAEQYGGTRDYWQGNGYWDPRS
GRPPGTGVVYDRTQGQVPDSLTDDREEEENWDQQDGSHFSDQSNKYLLSLQKDKGSVQAP
EISSNSIKDTLAVNEKKEFSKNLEKNDIKDRGPLKKRRQEIESDSESDGELQDRKKVRVE
VEQGETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKS
HRDIKRMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHA
DVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALK
NDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQR
YGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLA
DKNQVLSLCRLMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGR
ESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPPLSEGDGYSSENTSR
AHTPLNTPDPSTKLSTEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLD
QLENVPIEEEEELQSQQLLPQQLPECKVESETNIEASKLPTSEPEADTEIEPKESNGTKL
EEPLNEETPSQDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQ
TEKENTTAERGRDAVGFRDQTPAPKTPNRSRERDPDKQTQNKEKRKRRGSVSPPPSAYER
GTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPL
PYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPMV
GHSTEPLSAPPPVPVVPHVAASVEVSSSQYVAQSEGVVHQDSSVAVLPVPAPGPVQGQNY
SVWDSNQQSVSVQQQYSPAQSQATIYYQGQTCPAVYGVTSPYSQTTPPIVQSYAQPSLQY
IQGQQIFTAHPQGVVVQPAAAVTTIVAPGQPQPLQPSEMVVTNNLLDLPPPSPPKPKTIV
LPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMK
TSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLAR
KLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7725 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgcagccgcagccgcctccgaagatgggggatttctacgacccggagcac
ccgacccccgacatgttttcttggctgaatggaaatagagaagaagaaaatgaggcaaag
attgaaaatgtgcagaaaacaggtttcatcaaaggaccaatgttcaaaggtgttgcttct
agtcgatttttgcccaaaggcaccaagacaaaagttaatttggaagaacagggacgacag
aaggtgtcattcagcttcagccttacaaagaaaactttgcagaataggtttctcactgca
cttggcaatgaaaagcaaagtgatactccaaaccctccagctgtacctcttcaggtagac
tcaactcctaaaatgaaaatggaaattggtgataccttatctactgcagaagaatcttcc
ccaccaaagtcaagggtggaattgggcaaaattcattttaagaaacacctgcttcatgta
acatccaggccattgctggttactaccacagcagtagcatctccacctactcatgcagca
ccactaccagcagtgatagcagaatcaacaactgtagactcaccaccctcatctccacct
ccaccgcctccacctgcccaagccacaacaccctcatcaccagcaccaataacagagcca
gtggccttgccacatacaccagtaacagttctaatggcagcaccagtacccttaccagta
gatgtagcagttagatctctgaaagaaccaccaattataattgtaccagaatctttagaa
gcagatactaagcaggacactgtatctaatagttcagaagaacacataactcaaatattg
aatgagcaagcagatatttcctcaaaaaaagaagattcccatattgggaaggatgaagaa
attccagatagttctaagattagtctgagctgtaaaaaaacaggttctaagaagaaatcc
tcacaatctgaaggcacctttcttggttcagaatctgatgaagattctgtacggacttct
tcaagtcaaagatcacatgatttaaaattttcagcaagcattgaaagggaaagagatttt
aaaaagagctcagcacctttaaaaagtgaggatctagggaaatcttcacgatctaaaaca
gagagagatgataaatattttagctattcaaaacttgaaagagatactcggtatgtatct
tcccgatgtagatcagaaagagagcgacggcggagcagatctcattctaggtctgagaga
ggccctagaactaatttatcctattccaggtcagaacgatctcattattatgactctgat
cgtcgctaccataggagctccccttatcgagagaggacacgctattctcggccatacaca
gataacagagcacgagagagttctgactcagaagaagagtataagaagacatactcaagg
cgtacctcatctcattcctcttcttacagagacctaaggacatcatcctattctaaatct
gatcgggactgtaaaactgagacctcttacttagagatggaaagaagaggcaagtattct
tcaaaactagaaagagaatctaaaaggacttcagaaaatgaagcagttaaaagatgttgt
tctccccctaatgaactgggattccgacgagggtcatcatattctaagcacgacagtagt
gcttcccgttataaatctaccctttcaaaacctatacccaagtctgataaatttaaaaat
tctttctgttgtacagaattaaatgaagaaatcaaacagtctcattcttttagtttacag
acaccttgttcaaaaggtagtgaattaagaatgattaataaaaaccctgaaagagaaaag
gctgggtctccagctccatcaaatcgattaaatgattcacctactttaaaaaagctagat
gaatttcctatttttaagtctgaatttataacacatgatagccatgatagtattaaggaa
ttagactctttatctaaagtgaggaatgatcaattaagaagtttttgtcccatagaatta
aatataaatggatctcctggggcagaatctgatttagcaacattttgcacttctaaaact
gatgctgttttaatgacttctgatgatagtgtgactggatcggaagtatcccctttggtc
aaagcatgcatgctttcatcaaatggatttcagaatattagtagatgcaaaggaaaagac
ttggatgatacacgtatgctgcataagaagtcagaaagcccatttagagaaacagaacct
ctggtgtcaccacaccaagataaactcatgtctttgcaagttatgactatagattattcc
aaaactgtagttaaagaaccagttgatacgagggtttcttgctgcaaaaccaaagattca
gacatatactgtacttcaaatgatagcaacaacccttctttgtgtaactccgaagctgaa
aatatagaaccttcggttatgaagatttcttcaaatagctttatgaatgtgcatttggaa
tcaaaaccagttatatgtgatagtagaaatttgacagatcactcaaaatttgcatgtgaa
gaatataagcagagcatcggtagcactagttcagcttctgttaatcattttgatgattta
tatcagcctattgggagttcagatattgcttcatctcttcagagtcttccaccaggaata
aaggtggacagtctaactctcttgaaatgtggagagaacacatctccagttctggatgca
gtgctaaagagtagaaaaagttcggagtttttaaagcatgcagggaaagaaacagtagta
gaagtaggtagtgaccttcctgattcaggaaagggatttgcttccagggagaacaggcgt
aataatgggttatctgggaaatgtttgcaagaggctcaagaagaagggaattccatattg
cctgatagaagaggaagaccagaaatctctttacaggaaagaggagaaggaggacgtgtg
catacttctgatgactcagaagttgtattttcttcttgtgatttgaatttaaccatggaa
gacagtgatggtgtaacttacgcattaaagtgtgacagtagtggtcatgccccagaaatt
gtgtctactgtccatgaagattattctgactcttctgaaagttcaagtgatgaaagtgat
tcagaagatacagattcagatgatagcagtattccaagaaaccgtctccagtctgttgtg
gttgtgccaaagaattctactttgcccgtggaagaaacaagtccttgttcttctcggagc
agtcaaagttatagacactattctgaccattgggaagatgaaagattggagtcaaggaga
cattcatatgaggaaaaatttgaaagtatagcaaataaagcctgtcctcaaactgataag
tttttccttcataaaggagcagagaagaatccagaaatttcttttacacagtccaataga
aaacaaatagataaccacctgcctgaactttctcatcctcagagtgatggggttgatagt
acaagtcatacagatgtgaaatctgactctctgggtcacccaaattcagaggaaactgtg
aaagccaaaatatcttctaggcagcaagaggagctgccaatttattcttctgattttgaa
gatgtcccaaataagtcttggcaacagaccactttccaaaacaggccagatagtagactg
ggaaaaacagaattgagtttttcttcctcttgtgagatatcacgtgtggatggcttgcac
tcatcagaagagctcagaaacttaggttgggacttctctcaagaaaagccttctaccaca
tatcagcaacctgacagtagctatggaacttgtggtggacacaagtatcagcaaaatgca
gaacagtatggtgggacacgtgattactggcaaggcaatggttactgggatccaagatca
ggtagacctcctggaactggggttgtgtatgatcgaactcaaggacaagtaccagattcc
ctaacagatgatcgtgaagaagaggagaattgggatcaacaggatggatcccatttttca
gaccagtccaataagtatcttctatcccttcagaaagacaaggggtcagtgcaagcacct
gaaataagcagcaattccattaaggacactttagctgtgaatgaaaagaaagagttttca
aaaaacttagaaaaaaatgatatcaaagatagagggcctcttaaaaaaaggaggcaggaa
atagagagtgattctgaaagtgatggtgagcttcaggacagaaagaaagttagagtggag
gtagagcagggagagacatcagtgccaccaggctcagcactggttgggccctcctgtgtc
atggatgacttcagggacccacagcgatggaaggaatgtgccaagcaagggaaaatgcct
tgttactttgatcttattgaagaaaatgtttatttaacagaaagaaagaagaataaatct
catcgagatattaagcgaatgcagtgtgagtgtacacctctttctaaagatgaaagagct
caaggtgaaatagcatgtggagaagattgtcttaatcgtcttctcatgattgaatgttct
tctcggtgtccaaatggggattattgttccaatagacggtttcagagaaaacagcatgca
gatgtggaagtcatactcacagaaaagaaaggctggggcttgagagctgccaaagacctt
ccttcgaacacctttgtcctagaatattgtggagaggtactcgatcataaagagtttaaa
gctcgagtaaaggagtatgcacgaaacaaaaacatccattactatttcatggccctgaag
aatgatgagataatagatgccactcaaaaaggaaattgctctcgtttcatgaatcacagc
tgtgaaccaaactgtgaaacccaaaaatggactgtgaacggacaactgagggttgggttt
tttaccaccaaactggttccttcaggctcagagttaacatttgactatcagttccagaga
tatggaaaagaagcccagaaatgtttctgtggatcagccaattgccggggttacctggga
ggagaaaacagagtcagcatcagagcagcaggagggaaaatgaagaaggaacgatcccgt
aagaaggattcagtggatggagagctagaagctctgatggaaaatggtgagggtctcgct
gataaaaaccaggtgctcagcttatgccggctaatggttagaattgaaactttggagcag
aaacttacctgtctggaactcatacagaacacacactcacagtcctgcctgaagtccttt
ctggaacgtcatgggctgtctttgttgtggatctggatggcagagctaggtgacggccgg
gaaagtaaccagaagcttcaggaagagattataaagactttggaacacttgcccattcct
actaaaaatatgttggaggaaagcaaagtacttccaattattcaacgctggtctcagact
aagactgctgtccctccgttgagtgaaggagatgggtattctagtgagaatacatcgcgt
gctcacacaccactcaacacacctgatccttccaccaagctgagtacagaagctgacaca
gacactcccaagaaactaatgtttcgcagactgaaaattataagtgaaaatagcatggac
agtgcaatctctgatgcaaccagtgagctagaaggcaaggatggcaaagaggatcttgat
caattagaaaatgttcctatagaggaagaggaggagttgcagtcacaacagctactccca
caacagctgcctgaatgcaaagttgagagtgaaaccaacatagaggctagtaagctacct
acgtctgaaccagaagctgacactgaaatagagcccaaagagagcaatggaacaaaacta
gaagaacctcttaatgaagaaacaccatcccaagatgaagaagagggtgtgtctgatgtg
gagagtgaaaggagccaagaacagccagataaaacagtggatataagtgatttggccacc
aaactcctggacagttggaaagatctaaaggaggtatatcgaattccaaagaaaagtcaa
actgaaaaggagaacacaacagctgaacgaggaagggatgctgttggcttcagagatcaa
acacctgccccaaagactcctaataggtcaagagagagagacccagacaagcaaactcaa
aataaagagaaaaggaaacgaagaggctccgtctcaccaccaccttctgcctatgagcgg
ggaacaaaaaggccagatgacagatatgatacaccaacttctaaaaagaaagtacgaatt
aaagaccgcaataaactttctacagaggaacgccggaagttgtttgagcaagaggtggct
caacgggaggctcagaaacaacagcaacagatgcagaacctgggaatgacatcaccactg
ccctatgactctcttggttataatgccccacatcatccctttgctggttacccaccaggt
tatcccatgcaggcctatgtggatcccagcaaccctaatgctggaaaggtgctcctgccc
acacccagcatggacccagtgtgttctccagctccttatgatcatgctcagcccatggtg
ggacattctacagaacccctttctgccccaccaccagtaccagtggtgccacatgtggca
gcttctgtggaagtttccagttcccagtatgtggcccagagtgaaggtgtagtacaccaa
gactccagcgttgctgtcttgccagtgccggcccccggcccagttcagggacagaattat
agtgtctgggattcaaaccagcagtctgtcagtgtacagcagcagtactctcctgcacag
tctcaagcaaccatatattatcaaggacagacatgtccagcagtctatggtgtgacatca
ccttattcacagacaactccaccaattgtacagagttatgcccagccaagtcttcagtat
atccaggggcaacagattttcacagctcatccacaaggagtagtggtacagccagccgca
gcagtgactacaatagttgcaccagggcagcctcagcctttgcagccatctgaaatggtt
gtgacaaataatctcttggatctgccgcccccctctccacccaaaccaaaaactattgtc
ttacctcccaattggaagacagcccgagatccagaagggaagatttattactaccatgtg
atcacaaggcagactcagtgggatcctcctacttgggaaagtccaggagatgatgccagc
cttgagcatgaggctgagatggacctgggaactccaacatacgatgaaaaccccatgaag
acttcgaaaaagcccaagacagcagaagcagacacctccagtgaactagcaaagaaaagc
aaagaagtattcagaaaagagatgtcccagttcatcgtccagtgcctgaacccttaccgg
aaacctgactgcaaagtgggaagaattaccacaactgaagactttaaacatctggctcgc
aagctgactcacggtgttatgaataaggagctgaagtactgtaagaatcctgaggacctg
gagtgcaatgagaatgtgaaacacaaaaccaaggagtacattaagaagtacatgcaaaag
tttggggctgtttacaaacccaaagaggacactgagttagagtga

DBGET integrated database retrieval system