KEGG   Chlorocebus sabaeus (green monkey): 103228722Help
Entry
103228722         CDS       T04361                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103228722 (TGM1)
Enzymes [BR:csab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103228722 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103228722
NCBI-ProteinID: XP_007984510
Ensembl: ENSCSAG00000015944
LinkDB All DBs
Position
24
AA seq 890 aa AA seqDB search
MEGFWVSWLGLPGLRSHPRLFLTGMMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDRRFR
RGGGRSFWARCCGCCSCRNVADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRQPVSRGSG
VNAAGDGTIREGMLVVTGVDLLSSRSDQNRQEHHTDEYEYDELIVRRGQPFRMLLLLSRT
YESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKASGQTLNLRVHTSPNAI
IGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIY
YGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNG
VLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATR
TVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQ
VVDATPQETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIV
YVEEKAIGTLIVTKAIGSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSA
EDVAMQVEAQDAVMGQDLMVSVMLTNHSSSRRTVKLHLYLSVTFYTGVTGTIFKETKKEV
ELAPGACKCSLPSPAPWMAGHLRAVDMETPGAVGSPWGKPDVGKQASVTPCLFSPADRVT
MPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQEC
EVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLI
ASLDSPQLSQVHGVIQVDVAPAPGDRGFFSDAGDDSHLGETMPMASRGGA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggagggtttctgggtcagctggctggggctacctgggttaaggagccacccccgcctc
ttcctaacaggcatgatggacgggccacgttccgatgttggccgttggggtggcaacccc
ttgcagccccctaccacgccttctccagagccagaaccagagccagacagacgctttcgc
agaggaggaggccgttccttctgggctcgctgctgtggctgctgttcatgccgaaatgtg
gcagatgacgactggggacccgaaccctctgactccaggggtcgagggtccagctctggg
actcgaagacctggctcccggggctcagactcccgccagcctgtctcccggggcagcggt
gtcaatgcagctggagatggcaccatccgagagggcatgctagtagtgacaggtgtggac
ttgctgagctcgcgctcggaccagaaccgccaagagcaccacacagacgagtatgaatac
gatgagctgatagtacgtcgcgggcagcctttccgcatgcttctcctcctgtcccggacc
tatgaatcctctgatcgcatcacccttgagttactcatcggaaacaaccccgaggtgggc
aagggcacgcacgtgatcatcccagtgggcaaggggggcagtggaggctggaaagcccag
gtgaccaaggccagtgggcagactctgaacctacgggtccacacttcccccaatgccatc
atcggcaagtttcagttcacagtccgcacacagtcagacgctggggagttccagttgccc
tttgacccccgcaacgagatctacatcctcttcaacccctggtgcccagaggacattgtg
tacgtggaccatgaggattggcggcaggagtatgtgcttaatgagtctgggagaatttac
tacgggaccgaagcacagattggggagcggacctggaactacggccagtttgaccacggg
gtgctggatgcctgcctatacatcctggaccggcgggggatgccatatggaggccgtgga
gacccagtcagtgtctcccgggtcatctctgccatggtgaactccctggatgacaatgga
gtcctgattgggaactggtctggtgattactcccgaggcaccaacccatcagcgtgggtg
ggcagcgtggagatcctgcttagctacctacgcaccggctattccgtcccatatggccag
tgctgggtctttgctggcgtgaccactacagtgctgcgctgcctgggtctggccacccgt
actgtcaccaacttcaactccgcccatgacacagacacatctcttaccatggacatctac
ttcgatgagaacatgaagcccctagagcacctgaaccatgattctgtctggaacttccat
gtgtggaacgactgctggatgaagaggccagatcttccctcgggctttgatgggtggcag
gtggtggatgccacaccccaggagactagcagtggcatcttctgctgtggcccctgctcc
gtggagtccatcaagaatggcctggtctacatgaagtacgacacgcctttcatttttgct
gaggtgaatagtgacaaggtgtactggcagcggcaggacgatggcagcttcaagattgtg
tatgtagaggagaaggccatcggcacactcattgtcacaaaggccatcggctccaacatg
cgtgaggacatcacctacctctataagcacccagaaggctcagacgcggagcggaaggca
gtagagacagcagcagcccacggcagcaaacccaatgtgtacgccaaccggggctcagcg
gaggatgtggccatgcaggtggaggcgcaggacgcggtgatggggcaggatctgatggtc
tcggtcatgctgaccaatcacagcagcagccgccgcacagtgaaactgcacctctacctc
tcagtcaccttctatactggtgtcactgggaccatcttcaaggagaccaagaaggaagtg
gagctggcaccaggggcctgtaagtgctccttacccagccctgccccctggatggctggg
cacctcagggctgtggacatggagaccccaggagcagtggggagtccctgggggaagccg
gatgtggggaagcaggcctcagtgacgccatgcctcttctccccagcggaccgtgtgacc
atgccagtggcctacaaggaataccggccccaccttgtggaccagggggccatgctgctg
aacgtctcaggccacgtcaaggagagcgggcaggtgctggccaagcagcacaccttccgt
ctgcgtaccccagacctctccctcacgttactgggagcggcagtggttggccaggagtgt
gaagtacagattgtcttcaagaacccccttccggtcaccctcaccaatgtcgtcttccga
ctcgagggctctgggttacagaggcccaagatcctcaacgttggggacatcggaggcaat
gaaacagtgacactgcgccagacgtttgtgcctgtgcgaccaggcccccgccagctcatt
gccagcttggacagcccgcagctctcccaggtgcacggtgtcatccaggtggatgtggcc
ccagcccctggggacaggggcttcttctcagacgctggagatgacagtcacttgggagag
accatgcctatggcatctcgaggtggagcttag

DBGET integrated database retrieval system