KEGG   Chlorocebus sabaeus (green monkey): 103229386Help
Entry
103229386         CDS       T04361                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00350  Tyrosine metabolism
csab01100  Metabolic pathways
Module
csab_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103229386 (GSTZ1)
Enzymes [BR:csab01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     103229386 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37 GST_C_5
Motif
Other DBs
NCBI-GeneID: 103229386
NCBI-ProteinID: XP_007985585
Ensembl: ENSCSAG00000011812
LinkDB All DBs
Position
24
AA seq 227 aa AA seqDB search
MQAGKVCAAHPGGGKLPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKD
FQALNPMKQVPALKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGG
IQPLQNLSVLKQVEEEFQLTWAQNAIISGFNALEQILQSTAGTYCVGDEVTMADLCLVPQ
VANAERFKVDCTPYPTISSINKRLLVLEAFQVTHPCRQPDTPTELRA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggggaaggtctgtgccgcgcacccgggtggagggaaactgcccatcctctat
tcctatttccgaagctcctgctcatggagagttcgaattgctctggccttgaaaggcatt
gactatgagacggtgcccatcaatctcataaaggatgggggccaacagttctctaaggac
ttccaggcactgaatcccatgaagcaggtgccagccctgaagattgatggaatcaccatt
caccagtcactggccatcattgagtatctagaggagacgcgtcccactccgcgacttctg
cctcaggacccaaagaagagggccagcgtgcgtatgatttctgacctcattgctggtggc
atccagcccctgcagaacctgtctgtcctgaagcaagtggaagaggagttccagctgacc
tgggctcagaacgccatcatttctggatttaacgccctggagcagatcctacagagcacg
gcaggcacatactgtgtaggagatgaggtgaccatggctgatctgtgcttggtgcctcag
gtggcaaatgctgaaagattcaaggtggattgcaccccctaccctaccatcagctccata
aacaagaggctgctggtcctggaggccttccaggtgactcacccctgccggcagccggat
acacccactgagctgagggcctag

DBGET integrated database retrieval system