KEGG   Chlorocebus sabaeus (green monkey): 103230420Help
Entry
103230420         CDS       T04361                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00590  Arachidonic acid metabolism
csab01100  Metabolic pathways
csab04064  NF-kappa B signaling pathway
csab04370  VEGF signaling pathway
csab04625  C-type lectin receptor signaling pathway
csab04657  IL-17 signaling pathway
csab04668  TNF signaling pathway
csab04723  Retrograde endocannabinoid signaling
csab04726  Serotonergic synapse
csab04913  Ovarian steroidogenesis
csab04921  Oxytocin signaling pathway
csab04923  Regulation of lipolysis in adipocytes
csab05140  Leishmaniasis
csab05163  Human cytomegalovirus infection
csab05165  Human papillomavirus infection
csab05167  Kaposi sarcoma-associated herpesvirus infection
csab05200  Pathways in cancer
csab05204  Chemical carcinogenesis
csab05206  MicroRNAs in cancer
csab05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103230420 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103230420 (PTGS2)
   04064 NF-kappa B signaling pathway
    103230420 (PTGS2)
   04668 TNF signaling pathway
    103230420 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103230420 (PTGS2)
   04657 IL-17 signaling pathway
    103230420 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103230420 (PTGS2)
   04913 Ovarian steroidogenesis
    103230420 (PTGS2)
   04921 Oxytocin signaling pathway
    103230420 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    103230420 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    103230420 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    103230420 (PTGS2)
   05206 MicroRNAs in cancer
    103230420 (PTGS2)
   05204 Chemical carcinogenesis
    103230420 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    103230420 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    103230420 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103230420 (PTGS2)
   05165 Human papillomavirus infection
    103230420 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    103230420 (PTGS2)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103230420 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 103230420
NCBI-ProteinID: XP_007987337
Ensembl: ENSCSAG00000013318
LinkDB All DBs
Position
25
AA seq 604 aa AA seqDB search
MLARALLLCAVLALGHAANPCCSYPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNVDY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDNFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSRLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcagtcctggcgctcggccacgcagcaaatcct
tgctgttcctacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccaatat
aagtgcgattgtacccggacaggattctatggtgaaaactgctcaacaccggaatttctg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tacgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgttgactat
ggctacaaaagctgggaagccttctctaacctctcctattataccagagcccttcctcct
gtgcctgatgactgcccgactcccttgggtgtgaaaggtaagaagcagcttcctgattca
aatgagattgtggaaaaatttcttctaagaagaaagttcatccctgatccccagggcaca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaaaggactgggccatggggtggacttaaatcatatttat
ggtgaaactctagatagacagcataaactgcgcctgttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagttcctgagcatctgcagtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgagaacacaacagagtatgcgat
gtgcttaaacaggagcatccggaatggggtgatgagcagttgttccagacaagcaggctc
atactgataggagagactattaagattgtgattgaagattatgtacaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaacaccctctatcactggcatccccttctgcctgacaac
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatatta
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacaaaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaagttggagcaccgttctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcatcaaaacagtcaccatcaat
gcaagttcttctcgctccagactagatgatatcaatcccacagtactactaaaggaacgt
tcgactgaactgtag

DBGET integrated database retrieval system