KEGG   Chlorocebus sabaeus (green monkey): 103230478
Entry
103230478         CDS       T04361                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04020  Calcium signaling pathway
csab04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103230478 (CACNA1E)
   04020 Calcium signaling pathway
    103230478 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103230478 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csab04040]
    103230478 (CACNA1E)
Ion channels [BR:csab04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103230478 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 103230478
NCBI-ProteinID: XP_007987478
Ensembl: ENSCSAG00000012479
LinkDB
Position
25
AA seq 2310 aa
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAASYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRKHMQMSSQEALNREEAPSMNPLNPLSSLNPLNTHSSLYRRPRAIEGLALGLALE
KLEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAGGGE
AVVTFEDRARHRQSQRRSRHRRLRTEGKESSSASRSRSASQERSLDEAMPTEGEKDPELR
GNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEANAPLVLPHPELEVGKDMVPTE
QEPEGSSEQALLGDVQLDMGRVISQSEPDLSCITANTDKATTESTSVTVAIPDVGPLVDS
TVVHISNKTDGEASPLKEAEIREDDEEVENKKQKKEKRETGKAMVPHSSMFIFSTTNPIR
RACHYMVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVI
KMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVL
RPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSK
DTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVD
VTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNE
RACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAP
CTYELALKYLNMAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSK
LVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAI
IGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTT
APSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDE
FVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTV
HFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDL
TVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQ
DPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPSNHGI
YLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSS
ENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSE
ERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLPPVP
PKPRPLLSYSSLIRHVGTISPPADGSEEGSPLTSQALENNDTCLTESSNSPHPQQGQHAS
PQRYISEPYLALHEDSHVSDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHY
RRRRRGGPGPGMMCGAVNNLLSDTEEDDKC
NT seq 6933 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgccaggccggggtccggcgatggagactcggac
cagagcaggaaccggcaaggaacccccgtgccggcctcggggcaggcggcctcctacaag
cagacgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tatgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatcatt
gccaactgcatcgtgctggccctggagcagcatcttcctgaggatgacaagacccccatg
tcccgaagactggaaaagacagaaccttatttcattgggatcttttgctttgaagctggg
atcaaaattgtggccctggggttcatcttccataagggctcatacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcgggaacccacttc
aacactcatgtggacctgaggaccctccgggctgtgcgtgtcctgcggcccttgaagctc
gtgtcagggatacctagcctgcagattgtgttgaagtccatcatgaaggccatggtacct
cttctgcagattggccttctgctcttctttgccatcctgatgtttgctattattggcttg
gagttctacagtgggaagttacatcgagcatgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccgtgtggcgtgcagggctgcccagctggttatgaatgcaag
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctcatcatcattggatccttc
tttgttctcaacctagtcctgggagtgctttccggggaatttgccaaagagagagagaga
gtggagaaccgaagggctttcatgaaactgcggcgccagcagcagattgagcgtgaactg
aatggctaccgtgcctggatagacaaagcagaggaagtcatgctcgctgaagaaaataaa
aatgctggaacatctgccttagaagtgcttcgaagggcaaccatcaagaggagccggaca
gaggccatgacccgagactccagcgatgagcactgtgttgatatctcctctgtgggcaca
cctctggcccgagccagtatcaaaagtgcaaaggtagacggggtctcttatttccggcac
aaggaaaggcttctgcgcatctccattcgccacatggttaaatcccaggtgttttactgg
attgtgctgagccttgtagcactcaacactgcctgtgtggccattgtccatcacaaccag
ccgcagtggctcacccacctcctctactatgcagaatttctgtttctgggactcttcctc
ttggagatgtccctgaagatgtatggcatggggcctcgcctttattttcactcttcattc
aactgctttgattttggggtcacagtgggcagtatctttgaagtggtctgggcaatcttc
agacctggtacgtcttttggaatcagtgtcttgcgagccctccggcttctaagaatattt
aaaataaccaagtattgggcttccctgcggaatttggtggtctccttgatgagctcaatg
aagtctatcatcagtttacttttcctcctcttcctcttcatcgttgtctttgctctccta
ggaatgcagttatttggtggcaggtttaactttaatgatgggactccttcagcaaatttt
gacaccttccctgcagccatcatgaccgtgttccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcccagggcggggtcagctcaggcatgtggtccgcc
atctacttcattgtgcttaccttgtttggcaactacacgctactgaatgtgttcttggct
atcgctgtagataatctagccaacgcccaggagctgaccaaggatgaacaggaggaagaa
gaggccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttcgatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcggaggcgccggcaccacatgtctgtgtgggagcag
cgcaccagccagctgaggaagcacatgcagatgtccagccaggaggccctcaacagggag
gaggcgccgtccatgaacccgctcaacccactcagctccctcaacccactcaacacccac
tccagcctttatcggagacccagggccatcgagggcctggccctgggcctggccctggag
aagttggaggaggagcgcatcagccgtggggggtccctcaagggggatggaggggaccga
tccagtgccctggacaaccagaggacccccttgtccctgggccagcgggagccgccgtgg
ctggccaggccctgtcatgggaactgtgaccccactcagcaggaggcggggggaggagag
gctgtggtgacctttgaggaccgggccaggcacaggcagagccagcggcgcagccggcat
cgccgcctcaggacggaaggcaaggagtcctcctcagcctctcggagcaggtctgctagc
caggaacgcagtctggatgaagccatgcccactgaaggggagaaggaccctgagctcagg
ggcaaccatggtgccaaggagccaacgatccaagaagagagagcccaggatttaaggagg
accaacagtctgatggtgtccagaggctccgggctggcaggaggccttgatgaggccaat
gcccccttagtcctgccccatcctgagctggaagtggggaaggacatggtgccgacggag
caggagccggaaggtagcagtgagcaggccctgctgggggatgtgcagctagacatgggc
cgggtcatcagccagagtgagcccgacctctcctgcatcacggccaacacggacaaggcc
accaccgagagcaccagcgtgaccgtcgccatccccgacgtgggccccttggtggactca
accgtggtgcacattagcaacaagacggatggggaagccagtcccttgaaggaggcagag
atcagagaggatgatgaggaggtggagaataaaaagcagaagaaggagaagcgtgagaca
ggcaaagccatggtgccccacagctcaatgttcatcttcagcaccaccaacccgatccgg
agggcctgccactacatggtgaacctgcgctactttgagatgtgcatcctgctggtgatt
gcagccagcagcatcgccctggcggcagaggaccccgtcctgaccaactcagagcgcaac
aaagtcctgaggtattttgactatgtgttcactggcgtgttcacctttgagatggttata
aagatgatagaccaaggcttgatcctacaggacgggtcctacttccgagacctgtggaac
atcctggactttgtggtggtcgttggcgcattggtggcctttgctctggcgaacgctttg
ggaaccaacaaaggacgggacatcaagaccatcaagtctctgcgggtgctccgagttcta
aggccactgaaaaccatcaagcgcttgcccaagctcaaggctgtctttgactgcgtggtg
acctccttgaagaatgtcttcaacatacttattgtctacaagctcttcatgttcatcttt
gctgtcatcgcagttcaactcttcaagggaaagttcttttattgcacggacagttccaag
gacacagagaaggagtgcataggcaactatgtagatcatgagaaaaacaagatggaggtg
aaaggccgggaatggaagcgccatgaattccactacgacaacattatctgggccctgctg
accctcttcaccgtctccacgggggaaggatggcctcaagttctgcagcactctgtagat
gtgacagaggaagaccgaggcccaagccgcagcaaccgcatggagatgtctatcttttat
gtggtctactttgtggtcttccctttcttctttgtcaatatctttgtggctctcatcatc
atcaccttccaggagcaaggggataagatgatggaggagtgcagcctggagaagaatgag
agggcctgcatcgacttcgccatcagcgccaaacctctcacccgctacatgccgcagaac
aggcacaccttccagtaccgcgtgtggcactttgtggtgtctccgtccttcgaatacacc
attatggccatgatcgcgttgaataccgtcgtgctgatgatgaagtattactctgctccc
tgtacctatgagctggccctgaagtacctgaatatggccttcaccatggtgttttccctg
gaatgcgtcctgaaggtcatcgcttttggctttttgaactatttccgagacacctggaat
atctttgacttcatcaccgtgattggcagtataacagaaattatcctgacagacagcaag
ctggtgaacaccagtggcttcaatatgagctttctgaagctcttccgagctgcccgcctc
ataaagcttctgcgtcagggctataccatacgcattttgctgtggacctttgtgcagtcc
tttaaggccctcccttacgtctgccttttaattgccatgcttttcttcatttatgccatc
attgggatgcaggtatttggaaacataaaattagatgaggagagtcacatcaatcggcac
aacaacttccggagtttctttgggtccctaatgctactcttcaggagtgccacaggtgag
gcctggcaggagattatgctgtcatgcctcggggagaagggctgtgagcctgacaccacc
gcaccctcagggcagaacgagaatgagcgctgcggcaccgatctggcctacgtgtacttt
gtctccttcatcttcttctgctccttcttgatgctcaacctgttcgtggccgtcatcatg
gacaactttgagtacctgactcgggactcctccatcctggggcctcaccacttggatgag
tttgtccgtgtctgggcagaatatgaccgagcagcatgtggccgcatccattacactgag
atgtatgaaatgctgactctcatgtcacctccgctaggcctcggcaagagatgtccctcc
aaagtggcatataagaggttggtcctgatgaacatgccagtagctgaggacatgacggtc
cacttcacctccacacttatggctttgatccggacagctctggacattaaaattgccaaa
ggtggtgcagacaggcagcagctagactcagagctacaaaaggagaccctagccatctgg
cctcacctatcccagaagatgctggatctgcttgtgcccatgcccaaagcctctgacctg
actgtgggcaaaatctatgcagcaatgatgatcatggactactataagcagagtaaggtg
aagaagcagaggcagcagctggaggaacagaaaaatgcccccatgttccaacgcatggag
ccctcatctctgcctcaggagatcatcgctaatgccaaagccctgccttacctccagcag
gaccctgtttcaggcctgagtggccggagtggatacccttcgatgagtccactctctccc
caggagatattccagttggcttgtatggaccccgccgatgatggacagttccaggaacag
cagtctctggagccagaggttagtgaattaaaaagcgtgcagccctctaaccatggcatc
taccttccttcggacacccaggagcatgcgggatctgggagggcatcctctatgccacgt
ctgactgtggatccccaggtggtgacagaccctagctccatgagacgttcattttccact
attcgggataagcgttcaaattcctcgtggttggaggaattctccatggagcgaagcagt
gaaaatacctacaagtcccgtcgccggagttaccactcgtccttgcggctgtcagcccac
cgcctgaactctgattcaggccacaagtctgacactcaccgctcagggggcagggagaga
ggacgatcaaaagagcgaaagcatcttctctctcctgatgtctcccgctgcaattcagaa
gagcgagggacccaggctgactgggagtccccagagcgccgtcaatccaggtcacccagt
gagggcaggtcacagacgcccaacagacagggcacaggttccctaagtgagagctccatc
ccctctgtctctgacaccagcaccccaagaagaagtcgtcggcagctcccgcccgtccca
ccaaagccccggcccctcctttcctacagctccctgattcgacacgtgggcaccatctct
ccacctgctgatggaagcgaggagggctccccgctgacctcccaagcactggagaacaac
gacacttgcctgaccgagtcttccaactccccgcacccccagcagggccaacatgcctcc
ccacagcgctacatctccgagccctacttggccctgcacgaagactcccacgtctcagac
tgtggcgaggaggagacgctcacttttgaagcagcggtggctactagcctgggccgttcc
aacaccatcggctcagccccacccctgcggcacagctggcagatgcccaatgggcactat
cggcgacggaggcgcggggggcctgggccaggcatgatgtgtggggctgtcaacaacctg
ctaagtgacacggaagaagacgacaaatgctag

DBGET integrated database retrieval system