KEGG   Chlorocebus sabaeus (green monkey): 103233009Help
Entry
103233009         CDS       T04361                                 

Gene name
LPCAT2
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 2
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00564  Glycerophospholipid metabolism
csab00565  Ether lipid metabolism
csab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103233009 (LPCAT2)
   00565 Ether lipid metabolism
    103233009 (LPCAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:csab01004]
    103233009 (LPCAT2)
Enzymes [BR:csab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     103233009 (LPCAT2)
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     103233009 (LPCAT2)
Lipid biosynthesis proteins [BR:csab01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   103233009 (LPCAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 Acyltransferase EF-hand_5 EF-hand_8 EF-hand_4 IF2_N
Motif
Other DBs
NCBI-GeneID: 103233009
NCBI-ProteinID: XP_007991521
Ensembl: ENSCSAG00000005278
UniProt: A0A0D9QYZ8
LinkDB All DBs
Position
5
AA seq 544 aa AA seqDB search
MSRCAQAAAVAATVPAAGVGNVGLRPPMVPRQASFFPPPVPNPFVQQTQIGSARRVQIFL
LGIILLPIRVLLVALILLLAWPFAAISTVCCPEKLTDPVTGWRRKITQTALKFLGRAMFF
SMGFIVSVKGRIASPLEAPVFVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRMLR
AVQPILVSRVDPDSRKNTINEIIKRTTSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPG
VPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTKVEVEFMPVQVPNDEEKNDPV
LFANKVRNVMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRKLKLDWDGV
RKQLDEYASIASSSKGGRIGIDEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGL
AVLCNPANTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDS
ISYEEFKSFALRHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSIASNKVSPEKHEESASD
KKDD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagccggtgcgcccaggcggcggcagtggcggccacagtgccagctgccggcgtcggg
aacgtagggttgcggccacccatggtgccccgtcaggcgtccttcttcccgccgccggtg
cctaaccccttcgtgcagcagacgcagatcggctccgcgaggcgggtccagatttttctt
cttgggattatcctgcttccaattcgtgtcttattggttgctttaattttattacttgca
tggccatttgctgcaatttcaacagtatgctgtcctgaaaagctgaccgacccagtaact
ggttggaggaggaaaattactcaaacagctttgaaatttctgggtcgtgctatgttcttt
tcaatgggatttatagtttctgtaaaaggaaggattgcaagtcctttggaagcaccggtt
tttgttgctgcccctcattcaacattctttgatggaattgcctgtgttgtagctgggtta
ccttctatggtatctcgaaatgagaatgcacaagtccctctgattggcagaatgttacgg
gctgtgcaaccaattttggtgtcccgtgtagatccggattcccgaaaaaacacaataaat
gaaataataaagcgaacaacatcaggaggagaatggccccagatactagttttcccagaa
ggtacttgtactaatcgttcctgtttgattacttttaaaccaggagccttcattccagga
gttccagtgcagccagtcctcctcagatacccaaacaagctggatactgtgacctggaca
tggcaaggatatacattcattcagctttgcatgcttactttctgccagctcttcacaaag
gtagaagttgagtttatgccagttcaagtaccaaatgatgaagaaaaaaatgatcctgtc
ctttttgctaataaagtccggaatgtaatggcagaagctctgggaatacccgtaacagat
catacctacgaagattgcagattgatgatttcagcaggacagctaacattgcctatggaa
gctgggctggtggaatttactaaaattagccggaaattgaaattagattgggatggtgtt
cgtaagcaattggatgaatatgcatctatcgcgagttcctcaaaaggaggaagaattgga
attgacgaattcgccaagtatttaaagttgcctgtttcagatgtcttgagacaacttttt
gcactctttgacaggaaccatgacggcagcatcgacttccgagagtatgtgattggcctg
gctgtcttgtgcaaccctgccaatacagaggagatcatccaggtggcatttaagctcttt
gatgttgatgaggatggctacataacagaggaagagttctctaccattctacaggcttcc
cttggagtgcctgaccttgatgtttctggtctcttcaaggaaatagcccaaggggactca
atttcctatgaggaatttaaaagttttgccttaaggcatccagaatatgctaagatattt
acaacatacctagacctccagacgtgtcatgtgttttcattaccaaaagaagtccagaca
accccctccattgccagtaataaagtcagccctgaaaagcatgaagagagtgcctcagac
aaaaaagatgactga

DBGET integrated database retrieval system