KEGG   Chlorocebus sabaeus (green monkey): 103233645Help
Entry
103233645         CDS       T04361                                 

Gene name
DOT1L
Definition
(RefSeq) DOT1 like histone lysine methyltransferase
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00310  Lysine degradation
csab05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103233645 (DOT1L)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    103233645 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csab03036]
    103233645 (DOT1L)
Enzymes [BR:csab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103233645 (DOT1L)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103233645 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 103233645
NCBI-ProteinID: XP_007992892
Ensembl: ENSCSAG00000011808
LinkDB All DBs
Position
6
AA seq 1732 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGP
EGKLAGPTDAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMSTA
NPERKPKKNQTALDVLHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPT
PPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNTQLLGAAQQLLSHCQAQK
EEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRSQSLQLL
KARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDDALSLHLRGKGPLGRELEPDASRLHLELDCAKFSLPHLSSMSPELSMNGQAAGY
ELCSALSRPSSKQNTPQYLASPLDQEVVPCTPSHGGRPRLEKLSGLAAPDYTRLSPAKIV
LRRHLSQDHTVPGRPAASELHPRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQL
AGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARST
PSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGA
EPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGAAQGPI
PEASKGDLPSDSGFSDPESEAKRRIVFTIATGAGSAKQSPSSKHSPLTASARGDCVPSHG
QDSRKRGRRKRASTGTPSLSAGVSPKRRALPSAAGLFTQPSGSPLNLNSMVSNINQPLEI
TAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDEPSSARI
ERKIATISLESKSPPKTLENGGGLVGRKTTPASEPVNNSKWKSTFSPISDIGLAKSADSP
LQASSALSQNSLFTFRPALEEPPADAKLATHPRKGFPGSLSGADGLSPSTNPANGCTFGG
GLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEASDANPFLSKRQLDGLAGLK
GEGSRSKEAGEGGLQLCGPTDKTPLLTGKAAKARDRELDLKNGHNLFISAAAVPPGSLLS
GPGLAPVASSAGGAASSTQTHRPFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSS
VPAAAGLVHVSSAATRLTNSHAMGSFSGVAGSTVGGVFNHAVPSASAHPFGARVGRGAAC
GSATLGPSPLQAAASSFQAPASVETRPPPPPPPPPLPPPAHLGRPPAGPPVLHAPPPPNA
ALPPPPTLLASNPEPALLQSLASLPPNQAFLPPTSAASLPPANASLSIKLTSLPHKGARP
SFTVHHQPLPRLALAQAAPGIPQASATGPSAVWVSLGMPPPYAAHLSGVKPR
NT seq 5199 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgagactcaagtcgcccgtgggggctgagcccgccgtctac
ccgtggccgttgccggtctacgacaaacatcacgatgctgctcatgaaatcatcgagacc
atccgatgggtctgtgaagaaatcccggatctcaagctcgctatggagaattacgtttta
attgactatgacaccaaaagcttcgagagcatgcagaggctctgcgacaagtacaaccgc
gccatcgatagcatccaccagctgtggaagggcaccacgcagcccatgaagctgaacacg
cggccgtccactgggctcctgcgccacatcctgcagcaggtctacaaccactcagtgact
gaccccgagaagctcaacaactacgagcccttctcccctgaggtgtacggggagacctcc
ttcgacctggtggcccagatgatcgacgagatcaagatgaccgatgacgacctgtttgtg
gacttggggagcggtgtgggccaggtcgtgctccaggtcgccgctgccaccaactgcaaa
catcactatggcgtcgagaaagcggacatcccggccaagtatgcggagaccatggaccgc
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacattggagaga
ggcgatttcctctcagaagagtggagggagcgaatcgccaacacgagtgttatatttgtg
aataattttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcgaaaccctttgcacctctgaacttcagaataaac
agtagaaacttgagtgacatcggcaccatcatgcgcgtggtggagctgtcgcccctgaag
ggctcggtgtcgtggacggggaagccagtctcctactacctgcacactatcgaccgcacc
atacttgaaaactatttttctagtctgaaaaacccaaaactcagggaggaacaggaggca
gcccggcgccgccagcagcgcgagagcaagagcaacgcggccacgcccaccaagggcccc
gagggcaagctggccggccccaccgacgcccccatggactctggtgctgaggaagagaag
gcaggagcagccaccgtgaagaagccatctccctccaaagcccgtaagaagaagctcaac
aagaaggggaggaagatggctggccgcaagcgcgggcgccccaagaagatgagcactgcg
aaccccgagcggaagcccaagaagaaccaaactgcactggatgtcctgcacgcccagacc
gtgtctcagacggcagcctcctcgccccaggatgcctacaggtcccctcacagcccgttc
taccagctacctccgagcgtgcagcgtcactcccccaacccgctgctggtggcgcccacc
ccgcccgcgttgcagaagctgctagagtctttcaagatccagtacctgcagttcctggca
tacacaaagaccccccagtacaaggccagcctgcaggaactgctgggccaggagaaggag
aagaacacccagctcctgggcgcggctcagcagctcctcagccactgccaggcccagaag
gaggagatcaggaggctgttccagcaaaaattggatgagctgggcgtgaaggcgctgacc
tacaacgacctgattcaggcgcagaaggagatctccgcccacaaccagcagctgcgggag
cagtcagagcagctggagcaggacaaccgtgcgctgcgcagccagagcttgcagctgctc
aaggctcgctgcgaggagctgcagctggactgggccacgctgtccctggagaagctgctg
aaggagaagcaggccctgaagagccagatctcagagaagcagaggcactgcctggagctg
cagatcagcatcgtggagctggagaagagccagcggcagcaggagctcctgcagctcaag
tcctgtgtgccgcctgatgatgccctgtctctgcatctacgcgggaagggtcccctgggc
cgcgagctggagcctgacgccagccggctgcacctggagctggactgcgccaagttctcg
ctgcctcacttgagcagcatgagcccggagctctccatgaacggccaggctgccggctat
gagctctgcagcgcgctgagccggccctcgtccaagcagaacacaccccagtacctggcc
tcacccctcgaccaggaggtggtgccctgcacccccagccacggtggccggccacgcctg
gagaagctgtctggcctggctgcacccgactacaccaggctgtccccggccaagattgtg
ctgaggcggcacctgagccaggaccacacggtgcccggcaggccggccgccagtgagctg
cacccgagagctgagcacaccaaggagaacggccttccctaccagagccccagcgtgcct
ggcagcatgaagctgagtccccaggacccgcggcccctgtcacctggggccttgcagctt
gctggagagaagagcagtgagaagggcctgagagagcgcgcctacggcagcagcggggag
ctcatcaccagcctgcccatcagcatcccgctcagcaccgtgcagcccaacaagctcccg
gtcagcatccccctggccagcgtagtgctgcccagccgcgctgagagggcgaggagcacc
cccagtcccgtgctgcagccccgcgacccctcgtccacacttgaaaagcagattggtgct
aatgcccatggcgctgggagcagaagccttgccctggctcccgcaggcttctcctatgct
ggctcggtggccatcagcggagccttggcgggcagcccagcctctctcacacctggagcc
gagccggccaccttggatgagtcctccagctctgggagcctttttgccaccgtggggtcc
cgcagctccacaccacagcaccccctgctgctggcgcagccccggaactcgctcccggcc
tctcccgcccaccagctctcctccagcccccggcttggtggggctgcccagggcccgatc
cccgaggccagcaagggggacttgccctcagattccggtttctcagatcctgagagtgag
gccaagaggaggatcgtgttcaccatcgccactggtgcgggcagcgccaaacagtcgccc
tctagcaagcacagccccctgaccgccagcgcccgtggggactgcgtgccgagccacggg
caggacagccgcaagcgtgggcggcggaagcgagcatcgacggggacgcccagcttgagc
gcaggcgtgtcccccaagcgccgagccctgccgtccgccgctggccttttcacacagcct
tcggggtctcccctcaacctcaactccatggtcagtaacatcaaccagcccctggagatt
acagccatctcgtcccctgagacctccctgaagagctcccctgtgccctaccaggaccac
gaccagccccccgtgctcaagaaggagcggcctctgagccagaccaatggggcacactac
tccccgctcacctcggatgaggagccaggctctgaggatgagcccagcagcgcccgaatt
gagagaaaaattgcaacaatctccttagaaagcaaatctcccccgaaaaccttggaaaat
ggtggtggcttggtgggaaggaagaccacgcctgcgagcgagccagtcaacaacagcaag
tggaagtctactttctcgcccatctccgacatcggcctggccaagtctgcagacagcccg
ctgcaggccagctccgccctcagccagaactccctgttcacgttccggcccgccctggag
gagccccctgccgatgccaagctggccacccaccccaggaaaggctttcctggctctctg
tcgggggctgacggactcagcccgagcaccaaccctgccaacggctgcacctttggcggg
ggcctggcggcggacctgagtttacacagcttcagcgatggtgcttctcttccccacaag
ggccccgaggcggccggcctgagctccccgctgagcttcccctcgcagcgtggcaaggag
gcctcggacgccaaccctttcctgagcaagaggcagctggacggcctggctgggctgaag
ggcgagggcagccgcagcaaggaggcaggggagggcggcctgcagctgtgtgggcccacg
gacaagaccccgctgctgaccggcaaggccgccaaggcccgggaccgcgagctcgacctc
aagaatggccacaacctcttcatctccgctgcggctgtgcctcctggaagcctcctcagc
ggccccggcctggccccggtggcgtcctccgcaggcggcgcggcgtcctccacccagacg
caccggcccttcttgggccccttcccgccgggaccgcagttcgcgctcggccccatgtcc
ctgcaggccaacctcggctccgtggccggctcctccgtgctgcagtcgctgttcagctct
gtgccggctgccgcaggcctggtgcacgtgtcgtccgctgccaccagactgaccaactcg
cacgccatgggcagcttttccggggtggcaggcagcacagttggaggtgtctttaaccac
gcggtgccttccgcctctgctcatccgtttggagcccgtgtcggccgcggggctgcatgt
ggcagcgccacgctgggcccgagcccgctgcaagcggcggcctcttcctttcaggccccg
gcctcggttgagacccggccgccccctccgcctccgcctcccccgctgcccccgcctgcg
cacctgggccggccccccgcggggccgcccgtcctccacgccccgcctccacctaacgcc
gccttgcctcctcccccaacgctgctggcctctaaccctgagcccgcgcttctgcagagc
ctcgcgtccctcccgcctaaccaagctttcttgccccccacctctgctgcctctctgccg
cctgctaacgcctctttgtctatcaagctcacctccctcccgcacaagggcgcccgcccc
tccttcacggtgcaccaccagcccctgccccggctggccctggcccaggccgcgcccggg
atcccgcaggccagcgccacggggccgtccgcggtgtgggtgtccctcggcatgccgcct
ccctatgccgcgcacctttcgggggttaagccgcgataa

DBGET integrated database retrieval system