KEGG   Chlorocebus sabaeus (green monkey): 103235009Help
Entry
103235009         CDS       T04361                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00500  Starch and sucrose metabolism
csab01100  Metabolic pathways
csab04151  PI3K-Akt signaling pathway
csab04152  AMPK signaling pathway
csab04910  Insulin signaling pathway
csab04922  Glucagon signaling pathway
csab04931  Insulin resistance
Module
csab_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103235009 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103235009 (GYS1)
   04152 AMPK signaling pathway
    103235009 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103235009 (GYS1)
   04922 Glucagon signaling pathway
    103235009 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    103235009 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csab01003]
    103235009 (GYS1)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103235009 (GYS1)
Glycosyltransferases [BR:csab01003]
 Polysaccharide
  Storage polysaccharide
   103235009 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 103235009
NCBI-ProteinID: XP_007995675
Ensembl: ENSCSAG00000002773
UniProt: A0A0D9S336
LinkDB All DBs
Position
6
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEAPTPALKKTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPSEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLVEDSERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaatcgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaagtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacgggggatgaatggggcgac
aactactacctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaagacactggattccatgaacagcaagggttgcaag
gtgtattttgggcgctggttgatcgagggaggccctctggtggtgctcctggatgtgggg
gcgtcagcctgggccctggagcgctggaagggagagctctgggatacctgcaacatcgga
gtgccgtggtacgaccgcgaggccaacgatgctgtcctctttggctttctcaccacctgg
ttcctgggtgagttcctcgcgcagagtgaggagaagccacacgtggttgcccacttccat
gagtggttggcaggcattggactctgcctgtgtcgtgcccggcgactgcctgtagcaacc
attttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgctgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggggagaggcagatctatcac
cgctactgcatggaaagggcggcagcccactgcgctcacgtcttcactactgtgtcccag
atcactgccatcgaggcacagcacttgctcaagaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaaaggtgccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagtgagcag
acagtggttgccttcttcatcatgccggcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagccgtgcgcaaacagctttgggacacggccaacacggtgaaggagaagttc
gggaggaagctttacgaatccttactggttgggagccttcctgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctcccagtggactatgaggagtttgtccgtggctgt
caccttggggtcttcccatcctactatgagccttggggctacacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaatctctccggcttcggctgcttcatggaggaa
cacattgcagacccctcagcttacggtatctacattctcgaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccagcgaggcggatgcggcccaagggtaccgctacccacggccggcc
tcggtgccaccgtcgccctcactgtcacgacactccagcccgcaccagagcgaggacgag
gaggatccccggaacgggcctctggtggaagacagcgagcgctacgatgaggacgaggag
gccgccaaggatcggcgcaacattcgtgcaccagagtggccgcgccgagcatcctgcacc
tcctccaccagcgggagcaagcgcaactctgtggacacggccacctccagctcgctcagc
acccccagcgagcccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system