KEGG   Chlorocebus sabaeus (green monkey): 103235303Help
Entry
103235303         CDS       T04361                                 

Gene name
KMT5C, SUV420H2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103235303 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csab03036]
    103235303 (KMT5C)
Enzymes [BR:csab01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103235303 (KMT5C)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103235303 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 103235303
NCBI-ProteinID: XP_007996338
Ensembl: ENSCSAG00000001744
LinkDB All DBs
Position
6
AA seq 473 aa AA seqDB search
MDKWTVGWTVVMPPSRRGTGREAQLCGAQEEPAGQLLGERSQRQGQSPHGLGCGVEAGLR
EAGAAHGRQSSDLSCQGTVWWGAGSSGGHGLGCGRRDGSWHQATEAGGSGQHCWHGMLPE
GQVRSSSCREGWKPASGWIVQGLQAKDRPRARQPPPNATFRGSAVAPFQKRTLRARVSGQ
AWGMREPSPVPWARALSGLCPQFVPADGNAACVKVLRDIEPGDEVTCFYGDGFFGEKNEH
CECYTCERKGEGAFRTRPREPASPPRPLDKYQLRETKRRLQGLDSGGRQGLLGPRVCLHP
SPLRRHPFCAACQPLRLPACSVRPDTSPLWLQWLPQPQPRVRSRKRRRPRPQRAPVLSTH
HAARISLHRWGGCGPHCRLRGEALVTLGQPPRARWVPQQDWHWARRYGLPYVVRVDLRRL
APAPPATPAPAGTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVDGEEL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggataaatggacagttgggtggacagtggtcatgcccccttctagacggggaacaggg
agggaggcacagctgtgtggggcccaggaggagcctgcggggcagctcctgggtgaacga
tcccaaaggcagggccagagcccacacggattgggctgtggagtggaggcaggcctcaga
gaagcgggggcagcccatggcaggcagagctcagacctcagctgccaaggaacagtttgg
tggggggcaggcagctcaggagggcatgggcttgggtgtggcagaagagatgggtcttgg
caccaggccacagaggctggcgggagcggtcagcactgctggcacggcatgctgccagaa
ggtcaggttagatcatcgtcctgcagggaggggtggaaaccagccagtgggtggattgtc
caggggctacaggcaaaggacaggccccgggcaaggcagccgcctccgaatgccactttt
aggggctcggctgttgccccattccagaagaggacgctcagggccagggtgtccggccag
gcgtggggcatgcgtgagccctcccctgtgccctgggccagggcgctgagtgggctttgc
cctcagtttgtgcctgcagatgggaacgccgcctgtgtgaaggtgctccgggacatcgag
cctggggacgaggtgacgtgcttctacggtgatggcttcttcggcgagaagaatgagcac
tgtgaatgctacacctgtgagaggaaaggcgaaggagctttccgaacgagacctagggag
cctgcgtcgccaccacggcccctggacaagtaccagctacgtgagaccaagcggcggctg
caaggcctggacagcggcggccgacagggcctgctgggccctcgggtctgcctgcacccg
tccccactgcgccggcacccgttctgtgccgcctgccaacccctgcgcctgccagcctgt
agcgtccgcccagacacctcacccctctggctccagtggctgcctcagccccagccccga
gtgcggtcccggaagcgccgacgcccccggccccagagggccccagtgctctccacccat
cacgccgcccgcatctccctgcaccgatggggaggctgtggcccccactgccgcctgcga
ggagaggccctggtgaccctgggccagcccccccgtgcccgctgggttccccagcaggac
tggcattgggcccggcgctatgggctgccttacgtggtgcgtgtggaccttcgtcgcctg
gccccagccccaccagccaccccagcccctgctgggaccccaggccccatcctgatcccg
aagcaggccctcgccttcgcccccttctccccacccaagcgcctacggctggtggtcagc
cacggctccatcgacctagatgttgacggtgaagagctgtga

DBGET integrated database retrieval system